Je vous montre mes historiques :
Voici le derniere changement automatique genome vers folding....
[22:39:27] [SPG] Writing current.xyz
[22:39:27] [SPG] Sequence 30 completed:
[22:39:27] NLVAIWPYQAPTSNTLGYPSGFIMVPLNPNVGPYLYTWDPATGTKGAVPW . . .
[22:39:27] Iterations: 600 of 600
[22:39:28] Finished
[22:39:29] [SPG] Design complete
[22:39:29] [SPG] completed successfully
[22:39:29]
[22:39:29] Finished Work Unit
[22:39:29] work_hdr.len_arcfile: 112200
[22:39:30] Leaving Run
[22:39:32] - Writing 112712 bytes of core data to disk.
[22:39:32] end (WriteWorkResults)
[22:39:32] - Shutting down core
[22:39:32]
[22:39:32] Folding@Home2 Protein Design Core Shutdown: FINISHED_UNIT
[22:39:32] Left some temporary files
[22:39:35] CoreStatus = 64 (100)
[22:39:35] Sending work to server
[22:39:35] + Attempting to send results
[22:39:44] + Results successfully sent
[22:39:44] Thank you for your contribution to Folding@home.
[22:39:44] + Number of Units Completed: 7
[22:39:48] + Attempting to get work packet
[22:39:48] - Connecting to assignment server
[22:39:49] - Successful: assigned to (171.64.122.144).
[22:39:49] + News From Folding@Home: Welcome to Folding@Home
[22:39:49] Loaded queue successfully.
[22:40:02] + Closed connections
[22:40:02]
[22:40:02] + Processing work unit
[22:40:02] Core required: FahCore_78.exe
[22:40:02] Core not found.
[22:40:02] - Core is not present or corrupted.
[22:40:02] - Attempting to download new core...
[22:40:02] + Downloading new core: FahCore_78.exe
[22:40:04] + 10240 bytes downloaded
... downloading
[22:40:16] + 603591 bytes downloaded
[22:40:16] Verifying core Core_78.fah...
[22:40:16] Signature is VALID
[22:40:16] Created: Wednesday April 10, 2002 00:01:22 UTC
[22:40:16] Signed: Thursday April 3, 2003 00:01:22 UTC
[22:40:16]
[22:40:16] Trying to unzip core FahCore_78.exe
[22:40:16] Decompressed FahCore_78.exe (1728512 bytes) successfully
[22:40:16] + Core successfully engaged
[22:40:21]
[22:40:21] + Processing work unit
[22:40:21] Core required: FahCore_78.exe
[22:40:21] Core found.
[22:40:21] Working on Unit 08 [May 26 22:40:21]
[22:40:21] + Working ...
[22:40:21]
[22:40:21] *------------------------------*
[22:40:21] Folding@home Gromacs Core
[22:40:21] Version 1.48 (May 7, 2003)
[22:40:21]
[22:40:21] Preparing to commence simulation
[22:40:21] - Looking at optimizations...
[22:40:21] - Created dyn
[22:40:21] - Files status OK
[22:40:22] - Expanded 510614 -> 2524929 (decompressed 494.4 percent)
[22:40:22] - Starting from initial work packet
[22:40:22]
[22:40:22] Project: 909 (Run 41, Clone 86, Gen 1)
[22:40:22]
[22:40:22] Assembly optimizations on if available.
[22:40:22] Entering M.D.
[22:40:28] Protein: p909_vill_str0
[22:40:28]
[22:40:28] Writing local files
[22:40:30] Extra 3DNow boost OK.
[22:40:32] Writing local files
[22:40:32] Completed 0 out of 250000 steps (0)
[22:48:32] Writing local files
[22:48:32] Completed 2500 out of 250000 steps (1)
Voilà qu'en pensez vous ?
|