|
Venez Genomiser avec nous !
|
Thread Tools | Display Modes |
|
|
|
#32
|
|||
|
|||
|
Je vous montre mes historiques :
Voici le derniere changement automatique genome vers folding.... [22:39:27] [SPG] Writing current.xyz [22:39:27] [SPG] Sequence 30 completed: [22:39:27] NLVAIWPYQAPTSNTLGYPSGFIMVPLNPNVGPYLYTWDPATGTKGAVPW . . . [22:39:27] Iterations: 600 of 600 [22:39:28] Finished [22:39:29] [SPG] Design complete [22:39:29] [SPG] completed successfully [22:39:29] [22:39:29] Finished Work Unit [22:39:29] work_hdr.len_arcfile: 112200 [22:39:30] Leaving Run [22:39:32] - Writing 112712 bytes of core data to disk. [22:39:32] end (WriteWorkResults) [22:39:32] - Shutting down core [22:39:32] [22:39:32] Folding@Home2 Protein Design Core Shutdown: FINISHED_UNIT [22:39:32] Left some temporary files [22:39:35] CoreStatus = 64 (100) [22:39:35] Sending work to server [22:39:35] + Attempting to send results [22:39:44] + Results successfully sent [22:39:44] Thank you for your contribution to Folding@home. [22:39:44] + Number of Units Completed: 7 [22:39:48] + Attempting to get work packet [22:39:48] - Connecting to assignment server [22:39:49] - Successful: assigned to (171.64.122.144). [22:39:49] + News From Folding@Home: Welcome to Folding@Home [22:39:49] Loaded queue successfully. [22:40:02] + Closed connections [22:40:02] [22:40:02] + Processing work unit [22:40:02] Core required: FahCore_78.exe [22:40:02] Core not found. [22:40:02] - Core is not present or corrupted. [22:40:02] - Attempting to download new core... [22:40:02] + Downloading new core: FahCore_78.exe [22:40:04] + 10240 bytes downloaded ... downloading [22:40:16] + 603591 bytes downloaded [22:40:16] Verifying core Core_78.fah... [22:40:16] Signature is VALID [22:40:16] Created: Wednesday April 10, 2002 00:01:22 UTC [22:40:16] Signed: Thursday April 3, 2003 00:01:22 UTC [22:40:16] [22:40:16] Trying to unzip core FahCore_78.exe [22:40:16] Decompressed FahCore_78.exe (1728512 bytes) successfully [22:40:16] + Core successfully engaged [22:40:21] [22:40:21] + Processing work unit [22:40:21] Core required: FahCore_78.exe [22:40:21] Core found. [22:40:21] Working on Unit 08 [May 26 22:40:21] [22:40:21] + Working ... [22:40:21] [22:40:21] *------------------------------* [22:40:21] Folding@home Gromacs Core [22:40:21] Version 1.48 (May 7, 2003) [22:40:21] [22:40:21] Preparing to commence simulation [22:40:21] - Looking at optimizations... [22:40:21] - Created dyn [22:40:21] - Files status OK [22:40:22] - Expanded 510614 -> 2524929 (decompressed 494.4 percent) [22:40:22] - Starting from initial work packet [22:40:22] [22:40:22] Project: 909 (Run 41, Clone 86, Gen 1) [22:40:22] [22:40:22] Assembly optimizations on if available. [22:40:22] Entering M.D. [22:40:28] Protein: p909_vill_str0 [22:40:28] [22:40:28] Writing local files [22:40:30] Extra 3DNow boost OK. [22:40:32] Writing local files [22:40:32] Completed 0 out of 250000 steps (0) [22:48:32] Writing local files [22:48:32] Completed 2500 out of 250000 steps (1) Voilà qu'en pensez vous ? |
| Bookmarks |
«
Previous Thread
|
Next Thread
»
| Currently Active Users Viewing This Thread: 1 (0 members and 1 guests) | |
|
|
Similar Threads
|
||||
| Thread | Thread Starter | Forum | Replies | Last Post |
| Cours de français | Benjy | Discussions sur le site et/ou le forum | 47 | 01-05-2006 15:47 |
| Comparatif des gestionnaires de téléchargement | Kaspof | Articles | 106 | 27-02-2004 16:03 |
| Premiers pas sous Linux | Fred | Articles | 19 | 21-10-2003 06:46 |
| Citations du comique de Bagdad | stan | Discussions | 9 | 22-04-2003 17:12 |
| Free et ses projets | enzo19 | Discussions | 33 | 27-03-2003 20:53 |
All times are GMT +2. The time now is 00:54.
Powered by vBulletin® Version 3.8.4
Copyright ©2000 - 2025, Jelsoft Enterprises Ltd.
Copyright ©2000 - 2025, Jelsoft Enterprises Ltd.




























Threaded Mode

