Communauté Informatique NDFR.net : Venez Genomiser avec nous ! - Page 24 - Actualité
Reply
Venez Genomiser avec nous !
Thread Tools Display Modes
  #346  
Old 25-05-2003, 00:42
DelfinO DelfinO is offline
Membre junior
 
Join Date: 25-05-2003
Posts: 5
Send a message via ICQ to DelfinO Send a message via MSN to DelfinO
Yo c moi DelfinO
Reply With Quote
  #347  
Old 25-05-2003, 02:12
highlander highlander is offline
Membre senior
 
Join Date: 20-10-2002
Posts: 286
Bienvenue chez les Génomisateur DelfinO
Reply With Quote
  #348  
Old 25-05-2003, 04:18
Werner's Avatar
Werner Werner is offline
cOWboy attitUDe
 
Join Date: 15-09-2001
Location: Stuttgart
Age: 46
Posts: 2,961
Bienvenue dans l'équipe DelfinO
Reply With Quote
  #349  
Old 25-05-2003, 17:58
BeClaude's Avatar
BeClaude BeClaude is offline
Membre senior
 
Join Date: 20-10-2002
Location: Doubs
Age: 58
Posts: 608
Send a message via MSN to BeClaude
Salut à tous,

Et mialin c'est mon frero avec un celeron 1 000 Mhz OV a 1300 Mhz

Pour ma part j'ai pas compris mon dernier resultat est pas encore pris en compte j'ai refait la config du client j'espere que je ne fesait pas du Folding ???!!!!!!!!!!
__________________
Reply With Quote
  #350  
Old 25-05-2003, 21:10
Werner's Avatar
Werner Werner is offline
cOWboy attitUDe
 
Join Date: 15-09-2001
Location: Stuttgart
Age: 46
Posts: 2,961
Le frero est ajouté dans la liste
Reply With Quote
  #351  
Old 27-05-2003, 15:03
Mala's Avatar
Mala Mala is offline
Membre senior
 
Join Date: 27-10-2002
Location: Pas dans cette galaxie !
Age: 49
Posts: 313
Send a message via MSN to Mala
Une nouvelle recrue pour moi, un petit Duron 1.2 Ghz en plus ce qui me fait un total de 4.867 normalement

Allez au boulot tout le monde
Reply With Quote
  #352  
Old 27-05-2003, 18:12
DelfinO DelfinO is offline
Membre junior
 
Join Date: 25-05-2003
Posts: 5
Send a message via ICQ to DelfinO Send a message via MSN to DelfinO
Euh, je n'ai pas tout suivi, au début, il calcule pour genome@home mais maintenant, il calcule folding@home je crois..... ? pourtant je n'ai pas touché ce progs depuis le début non stop. (genre il calcule 120 000 / 500 000)
Reply With Quote
  #353  
Old 27-05-2003, 18:26
Cougar's Avatar
Cougar Cougar is offline
Membre senior
 
Join Date: 16-09-2001
Location: Orléans
Age: 40
Posts: 3,850
Send a message via MSN to Cougar
Ton client.cfg se présente comme ça (à ouvrir avec le bloc note) :
Code:
[settings]
username=NDFRCougar
team=704901201
asknet=no
machineid=1
local=49

[http]
active=no
host=localhost
port=8080
usereg=yes
usepasswd=yes

[clienttype]
type=2

[core]
priority=96
cpuusage=100
disableassembly=no
ignoredeadlines=no
vérifie que t'es bien 2 en face de type.
si c'est pas le cas, met le
__________________
Reply With Quote
  #354  
Old 27-05-2003, 18:52
DelfinO DelfinO is offline
Membre junior
 
Join Date: 25-05-2003
Posts: 5
Send a message via ICQ to DelfinO Send a message via MSN to DelfinO
oulà, c tout completement différents :

[settings]
username=DelfinO
team=704901201
asknet=no
machineid=1
local=8

[http]
active=no
host=localhost
port=8080
usereg=no
Reply With Quote
  #355  
Old 27-05-2003, 18:57
DelfinO DelfinO is offline
Membre junior
 
Join Date: 25-05-2003
Posts: 5
Send a message via ICQ to DelfinO Send a message via MSN to DelfinO
Je vous montre mes historiques :

Voici le derniere changement automatique genome vers folding....

[22:39:27] [SPG] Writing current.xyz
[22:39:27] [SPG] Sequence 30 completed:
[22:39:27] NLVAIWPYQAPTSNTLGYPSGFIMVPLNPNVGPYLYTWDPATGTKGAVPW . . .
[22:39:27] Iterations: 600 of 600
[22:39:28] Finished
[22:39:29] [SPG] Design complete
[22:39:29] [SPG] completed successfully
[22:39:29]
[22:39:29] Finished Work Unit
[22:39:29] work_hdr.len_arcfile: 112200
[22:39:30] Leaving Run
[22:39:32] - Writing 112712 bytes of core data to disk.
[22:39:32] end (WriteWorkResults)
[22:39:32] - Shutting down core
[22:39:32]
[22:39:32] Folding@Home2 Protein Design Core Shutdown: FINISHED_UNIT
[22:39:32] Left some temporary files
[22:39:35] CoreStatus = 64 (100)
[22:39:35] Sending work to server


[22:39:35] + Attempting to send results
[22:39:44] + Results successfully sent
[22:39:44] Thank you for your contribution to Folding@home.
[22:39:44] + Number of Units Completed: 7
[22:39:48] + Attempting to get work packet
[22:39:48] - Connecting to assignment server
[22:39:49] - Successful: assigned to (171.64.122.144).
[22:39:49] + News From Folding@Home: Welcome to Folding@Home
[22:39:49] Loaded queue successfully.
[22:40:02] + Closed connections
[22:40:02]
[22:40:02] + Processing work unit
[22:40:02] Core required: FahCore_78.exe
[22:40:02] Core not found.
[22:40:02] - Core is not present or corrupted.
[22:40:02] - Attempting to download new core...
[22:40:02] + Downloading new core: FahCore_78.exe
[22:40:04] + 10240 bytes downloaded
... downloading
[22:40:16] + 603591 bytes downloaded
[22:40:16] Verifying core Core_78.fah...
[22:40:16] Signature is VALID
[22:40:16] Created: Wednesday April 10, 2002 00:01:22 UTC
[22:40:16] Signed: Thursday April 3, 2003 00:01:22 UTC
[22:40:16]
[22:40:16] Trying to unzip core FahCore_78.exe
[22:40:16] Decompressed FahCore_78.exe (1728512 bytes) successfully
[22:40:16] + Core successfully engaged
[22:40:21]
[22:40:21] + Processing work unit
[22:40:21] Core required: FahCore_78.exe
[22:40:21] Core found.
[22:40:21] Working on Unit 08 [May 26 22:40:21]
[22:40:21] + Working ...
[22:40:21]
[22:40:21] *------------------------------*
[22:40:21] Folding@home Gromacs Core
[22:40:21] Version 1.48 (May 7, 2003)
[22:40:21]
[22:40:21] Preparing to commence simulation
[22:40:21] - Looking at optimizations...
[22:40:21] - Created dyn
[22:40:21] - Files status OK
[22:40:22] - Expanded 510614 -> 2524929 (decompressed 494.4 percent)
[22:40:22] - Starting from initial work packet
[22:40:22]
[22:40:22] Project: 909 (Run 41, Clone 86, Gen 1)
[22:40:22]
[22:40:22] Assembly optimizations on if available.
[22:40:22] Entering M.D.
[22:40:28] Protein: p909_vill_str0
[22:40:28]
[22:40:28] Writing local files
[22:40:30] Extra 3DNow boost OK.
[22:40:32] Writing local files
[22:40:32] Completed 0 out of 250000 steps (0)
[22:48:32] Writing local files
[22:48:32] Completed 2500 out of 250000 steps (1)



Voilà qu'en pensez vous ?
Reply With Quote
  #356  
Old 27-05-2003, 18:59
Cougar's Avatar
Cougar Cougar is offline
Membre senior
 
Join Date: 16-09-2001
Location: Orléans
Age: 40
Posts: 3,850
Send a message via MSN to Cougar
bah tu peux mettre tout comme moi (sauf l'username bien sur)

"Quand tu lances pour la preières fois FAHConsole.exe tu remplies les informations...puis quand il te demande de configurer les "advanced option" tu met yes, et là tu mettras gah quand t'auras le choix entre gah/fah/nopref. "

Ou tu peux modifier dès maintenant le client.cfg à la main, au ipre si ça marche toujours pas du supprimes tous les fichiers sauf fahconsole.exe

jvais ptet faire un prog permettant de corriger ça, histoire de m'occuper un peu
__________________
Reply With Quote
  #357  
Old 27-05-2003, 19:07
DelfinO DelfinO is offline
Membre junior
 
Join Date: 25-05-2003
Posts: 5
Send a message via ICQ to DelfinO Send a message via MSN to DelfinO
D'accord mais pourquoi il change le programme genome en folding tout seul....

t'as regardé, c bien çà folding@home alors ? si oui je vais fermer et relancer.
Reply With Quote
  #358  
Old 27-05-2003, 20:18
Cougar's Avatar
Cougar Cougar is offline
Membre senior
 
Join Date: 16-09-2001
Location: Orléans
Age: 40
Posts: 3,850
Send a message via MSN to Cougar
bah pasque pendant l'installation, t'as pas spécifié les "advenced options", du coups le programme fait soit du genome, soit du folding, si par contre tu précises fah (type=2) il ne fera QUE du genome

D'après tes logs tu faisais du folding
__________________
Reply With Quote
  #359  
Old 28-05-2003, 21:24
mialin mialin is offline
Membre junior
 
Join Date: 26-05-2003
Location: auto
Age: 65
Posts: 6
bonjour de mialin
Reply With Quote
  #360  
Old 07-02-2004, 23:06
streets's Avatar
streets streets is offline
KiLL BiLL
 
Join Date: 26-10-2002
Location: sezam street
Posts: 1,798
Send a message via MSN to streets
Excellent Re: Venez Genomiser avec nous !

Ba ca fait longtemps qui'il est down ce topic

Alors up avec la version 4 de Folding@Home qui est sortit je ne sais quand d'ailleur . . . :rolleyes:
Allez voir par ici si ca vous dit
__________________
"Il y a au moins deux solutions à un problème "


"Internet tue des bébés loutre"
Reply With Quote
Reply

Bookmarks


Currently Active Users Viewing This Thread: 4 (0 members and 4 guests)
 

Posting Rules
You may not post new threads
You may post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off

Forum Jump

Similar Threads
Thread Thread Starter Forum Replies Last Post
Cours de français Benjy Discussions sur le site et/ou le forum 47 01-05-2006 14:47
Comparatif des gestionnaires de téléchargement Kaspof Articles 106 27-02-2004 15:03
Premiers pas sous Linux Fred Articles 19 21-10-2003 05:46
Citations du comique de Bagdad stan Discussions 9 22-04-2003 16:12
Free et ses projets enzo19 Discussions 33 27-03-2003 19:53

All times are GMT +2. The time now is 17:08.

Powered by vBulletin® Version 3.8.4
Copyright ©2000 - 2025, Jelsoft Enterprises Ltd.