![]() |
|
Venez Genomiser avec nous !
|
Thread Tools | Display Modes |
|
#346
|
|||
|
|||
|
Yo c moi DelfinO
|
|
#347
|
|||
|
|||
|
Bienvenue chez les Génomisateur DelfinO
|
|
#348
|
||||
|
||||
|
Bienvenue dans l'équipe DelfinO
|
|
#349
|
||||
|
||||
|
Salut à tous,
Et mialin c'est mon frero avec un celeron 1 000 Mhz OV a 1300 Mhz ![]() Pour ma part j'ai pas compris mon dernier resultat est pas encore pris en compte j'ai refait la config du client j'espere que je ne fesait pas du Folding ???!!!!!!!!!!
__________________
|
|
#350
|
||||
|
||||
|
Le frero est ajouté dans la liste
|
|
#351
|
||||
|
||||
|
Une nouvelle recrue pour moi, un petit Duron 1.2 Ghz en plus ce qui me fait un total de 4.867 normalement
![]() Allez au boulot tout le monde
|
|
#352
|
|||
|
|||
|
Euh, je n'ai pas tout suivi, au début, il calcule pour genome@home mais maintenant, il calcule folding@home je crois..... ? pourtant je n'ai pas touché ce progs depuis le début non stop. (genre il calcule 120 000 / 500 000)
|
|
#353
|
||||
|
||||
|
Ton client.cfg se présente comme ça (à ouvrir avec le bloc note) :
Code:
[settings] username=NDFRCougar team=704901201 asknet=no machineid=1 local=49 [http] active=no host=localhost port=8080 usereg=yes usepasswd=yes [clienttype] type=2 [core] priority=96 cpuusage=100 disableassembly=no ignoredeadlines=no si c'est pas le cas, met le
|
|
#354
|
|||
|
|||
|
oulà, c tout completement différents :
[settings] username=DelfinO team=704901201 asknet=no machineid=1 local=8 [http] active=no host=localhost port=8080 usereg=no |
|
#355
|
|||
|
|||
|
Je vous montre mes historiques :
Voici le derniere changement automatique genome vers folding.... [22:39:27] [SPG] Writing current.xyz [22:39:27] [SPG] Sequence 30 completed: [22:39:27] NLVAIWPYQAPTSNTLGYPSGFIMVPLNPNVGPYLYTWDPATGTKGAVPW . . . [22:39:27] Iterations: 600 of 600 [22:39:28] Finished [22:39:29] [SPG] Design complete [22:39:29] [SPG] completed successfully [22:39:29] [22:39:29] Finished Work Unit [22:39:29] work_hdr.len_arcfile: 112200 [22:39:30] Leaving Run [22:39:32] - Writing 112712 bytes of core data to disk. [22:39:32] end (WriteWorkResults) [22:39:32] - Shutting down core [22:39:32] [22:39:32] Folding@Home2 Protein Design Core Shutdown: FINISHED_UNIT [22:39:32] Left some temporary files [22:39:35] CoreStatus = 64 (100) [22:39:35] Sending work to server [22:39:35] + Attempting to send results [22:39:44] + Results successfully sent [22:39:44] Thank you for your contribution to Folding@home. [22:39:44] + Number of Units Completed: 7 [22:39:48] + Attempting to get work packet [22:39:48] - Connecting to assignment server [22:39:49] - Successful: assigned to (171.64.122.144). [22:39:49] + News From Folding@Home: Welcome to Folding@Home [22:39:49] Loaded queue successfully. [22:40:02] + Closed connections [22:40:02] [22:40:02] + Processing work unit [22:40:02] Core required: FahCore_78.exe [22:40:02] Core not found. [22:40:02] - Core is not present or corrupted. [22:40:02] - Attempting to download new core... [22:40:02] + Downloading new core: FahCore_78.exe [22:40:04] + 10240 bytes downloaded ... downloading [22:40:16] + 603591 bytes downloaded [22:40:16] Verifying core Core_78.fah... [22:40:16] Signature is VALID [22:40:16] Created: Wednesday April 10, 2002 00:01:22 UTC [22:40:16] Signed: Thursday April 3, 2003 00:01:22 UTC [22:40:16] [22:40:16] Trying to unzip core FahCore_78.exe [22:40:16] Decompressed FahCore_78.exe (1728512 bytes) successfully [22:40:16] + Core successfully engaged [22:40:21] [22:40:21] + Processing work unit [22:40:21] Core required: FahCore_78.exe [22:40:21] Core found. [22:40:21] Working on Unit 08 [May 26 22:40:21] [22:40:21] + Working ... [22:40:21] [22:40:21] *------------------------------* [22:40:21] Folding@home Gromacs Core [22:40:21] Version 1.48 (May 7, 2003) [22:40:21] [22:40:21] Preparing to commence simulation [22:40:21] - Looking at optimizations... [22:40:21] - Created dyn [22:40:21] - Files status OK [22:40:22] - Expanded 510614 -> 2524929 (decompressed 494.4 percent) [22:40:22] - Starting from initial work packet [22:40:22] [22:40:22] Project: 909 (Run 41, Clone 86, Gen 1) [22:40:22] [22:40:22] Assembly optimizations on if available. [22:40:22] Entering M.D. [22:40:28] Protein: p909_vill_str0 [22:40:28] [22:40:28] Writing local files [22:40:30] Extra 3DNow boost OK. [22:40:32] Writing local files [22:40:32] Completed 0 out of 250000 steps (0) [22:48:32] Writing local files [22:48:32] Completed 2500 out of 250000 steps (1) Voilà qu'en pensez vous ? |
|
#356
|
||||
|
||||
|
bah tu peux mettre tout comme moi (sauf l'username bien sur)
"Quand tu lances pour la preières fois FAHConsole.exe tu remplies les informations...puis quand il te demande de configurer les "advanced option" tu met yes, et là tu mettras gah quand t'auras le choix entre gah/fah/nopref. " Ou tu peux modifier dès maintenant le client.cfg à la main, au ipre si ça marche toujours pas du supprimes tous les fichiers sauf fahconsole.exe ![]() jvais ptet faire un prog permettant de corriger ça, histoire de m'occuper un peu
|
|
#357
|
|||
|
|||
|
D'accord mais pourquoi il change le programme genome en folding tout seul....
t'as regardé, c bien çà folding@home alors ? si oui je vais fermer et relancer. |
|
#358
|
||||
|
||||
|
bah pasque pendant l'installation, t'as pas spécifié les "advenced options", du coups le programme fait soit du genome, soit du folding, si par contre tu précises fah (type=2) il ne fera QUE du genome
![]() D'après tes logs tu faisais du folding
|
|
#359
|
|||
|
|||
|
bonjour de mialin
|
|
#360
|
||||
|
||||
|
Ba ca fait longtemps qui'il est down ce topic
Alors up avec la version 4 de Folding@Home qui est sortit je ne sais quand d'ailleur . . . :rolleyes: Allez voir par ici si ca vous dit
__________________
"Il y a au moins deux solutions à un problème "![]() "Internet tue des bébés loutre" |
![]() |
| Bookmarks |
«
Previous Thread
|
Next Thread
»
| Currently Active Users Viewing This Thread: 4 (0 members and 4 guests) | |
|
|
Similar Threads
|
||||
| Thread | Thread Starter | Forum | Replies | Last Post |
| Cours de français | Benjy | Discussions sur le site et/ou le forum | 47 | 01-05-2006 15:47 |
| Comparatif des gestionnaires de téléchargement | Kaspof | Articles | 106 | 27-02-2004 16:03 |
| Premiers pas sous Linux | Fred | Articles | 19 | 21-10-2003 06:46 |
| Citations du comique de Bagdad | stan | Discussions | 9 | 22-04-2003 17:12 |
| Free et ses projets | enzo19 | Discussions | 33 | 27-03-2003 20:53 |
All times are GMT +2. The time now is 07:47.
Powered by vBulletin® Version 3.8.4
Copyright ©2000 - 2026, Jelsoft Enterprises Ltd.
Copyright ©2000 - 2026, Jelsoft Enterprises Ltd.





























Linear Mode


