Communauté Informatique NDFR.net : Venez Genomiser avec nous ! - Actualité
 
Venez Genomiser avec nous !
Thread Tools Display Modes
Prev Previous Post   Next Post Next
  #32  
Old 27-05-2003, 19:57
DelfinO DelfinO is offline
Membre junior
 
Join Date: 25-05-2003
Posts: 5
Send a message via ICQ to DelfinO Send a message via MSN to DelfinO
Je vous montre mes historiques :

Voici le derniere changement automatique genome vers folding....

[22:39:27] [SPG] Writing current.xyz
[22:39:27] [SPG] Sequence 30 completed:
[22:39:27] NLVAIWPYQAPTSNTLGYPSGFIMVPLNPNVGPYLYTWDPATGTKGAVPW . . .
[22:39:27] Iterations: 600 of 600
[22:39:28] Finished
[22:39:29] [SPG] Design complete
[22:39:29] [SPG] completed successfully
[22:39:29]
[22:39:29] Finished Work Unit
[22:39:29] work_hdr.len_arcfile: 112200
[22:39:30] Leaving Run
[22:39:32] - Writing 112712 bytes of core data to disk.
[22:39:32] end (WriteWorkResults)
[22:39:32] - Shutting down core
[22:39:32]
[22:39:32] Folding@Home2 Protein Design Core Shutdown: FINISHED_UNIT
[22:39:32] Left some temporary files
[22:39:35] CoreStatus = 64 (100)
[22:39:35] Sending work to server


[22:39:35] + Attempting to send results
[22:39:44] + Results successfully sent
[22:39:44] Thank you for your contribution to Folding@home.
[22:39:44] + Number of Units Completed: 7
[22:39:48] + Attempting to get work packet
[22:39:48] - Connecting to assignment server
[22:39:49] - Successful: assigned to (171.64.122.144).
[22:39:49] + News From Folding@Home: Welcome to Folding@Home
[22:39:49] Loaded queue successfully.
[22:40:02] + Closed connections
[22:40:02]
[22:40:02] + Processing work unit
[22:40:02] Core required: FahCore_78.exe
[22:40:02] Core not found.
[22:40:02] - Core is not present or corrupted.
[22:40:02] - Attempting to download new core...
[22:40:02] + Downloading new core: FahCore_78.exe
[22:40:04] + 10240 bytes downloaded
... downloading
[22:40:16] + 603591 bytes downloaded
[22:40:16] Verifying core Core_78.fah...
[22:40:16] Signature is VALID
[22:40:16] Created: Wednesday April 10, 2002 00:01:22 UTC
[22:40:16] Signed: Thursday April 3, 2003 00:01:22 UTC
[22:40:16]
[22:40:16] Trying to unzip core FahCore_78.exe
[22:40:16] Decompressed FahCore_78.exe (1728512 bytes) successfully
[22:40:16] + Core successfully engaged
[22:40:21]
[22:40:21] + Processing work unit
[22:40:21] Core required: FahCore_78.exe
[22:40:21] Core found.
[22:40:21] Working on Unit 08 [May 26 22:40:21]
[22:40:21] + Working ...
[22:40:21]
[22:40:21] *------------------------------*
[22:40:21] Folding@home Gromacs Core
[22:40:21] Version 1.48 (May 7, 2003)
[22:40:21]
[22:40:21] Preparing to commence simulation
[22:40:21] - Looking at optimizations...
[22:40:21] - Created dyn
[22:40:21] - Files status OK
[22:40:22] - Expanded 510614 -> 2524929 (decompressed 494.4 percent)
[22:40:22] - Starting from initial work packet
[22:40:22]
[22:40:22] Project: 909 (Run 41, Clone 86, Gen 1)
[22:40:22]
[22:40:22] Assembly optimizations on if available.
[22:40:22] Entering M.D.
[22:40:28] Protein: p909_vill_str0
[22:40:28]
[22:40:28] Writing local files
[22:40:30] Extra 3DNow boost OK.
[22:40:32] Writing local files
[22:40:32] Completed 0 out of 250000 steps (0)
[22:48:32] Writing local files
[22:48:32] Completed 2500 out of 250000 steps (1)



Voilà qu'en pensez vous ?
Reply With Quote
 

Bookmarks


Currently Active Users Viewing This Thread: 1 (0 members and 1 guests)
 
Thread Tools
Display Modes

Posting Rules
You may not post new threads
You may post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off

Forum Jump

Similar Threads
Thread Thread Starter Forum Replies Last Post
Cours de français Benjy Discussions sur le site et/ou le forum 47 01-05-2006 15:47
Comparatif des gestionnaires de téléchargement Kaspof Articles 106 27-02-2004 16:03
Premiers pas sous Linux Fred Articles 19 21-10-2003 06:46
Citations du comique de Bagdad stan Discussions 9 22-04-2003 17:12
Free et ses projets enzo19 Discussions 33 27-03-2003 20:53

All times are GMT +2. The time now is 18:39.

Powered by vBulletin® Version 3.8.4
Copyright ©2000 - 2025, Jelsoft Enterprises Ltd.