Communauté Informatique NDFR.net

Communauté Informatique NDFR.net (http://www.ndfr.net/forums/index.php)
-   Actualité (http://www.ndfr.net/forums/forumdisplay.php?f=71)
-   -   Venez Genomiser avec nous ! (http://www.ndfr.net/forums/showthread.php?t=1219)

DelfinO 25-05-2003 01:42

Yo c moi DelfinO :)

highlander 25-05-2003 03:12

Bienvenue chez les Génomisateur DelfinO :)

Werner 25-05-2003 05:18

Bienvenue dans l'équipe DelfinO :)

BeClaude 25-05-2003 18:58

Salut à tous,

Et mialin c'est mon frero avec un celeron 1 000 Mhz OV a 1300 Mhz :)

Pour ma part j'ai pas compris mon dernier resultat est pas encore pris en compte j'ai refait la config du client j'espere que je ne fesait pas du Folding ???!!!!!!!!!!

Werner 25-05-2003 22:10

Le frero est ajouté dans la liste ;)

Mala 27-05-2003 16:03

Une nouvelle recrue pour moi, un petit Duron 1.2 Ghz en plus ce qui me fait un total de 4.867 normalement :)

Allez au boulot tout le monde :D

DelfinO 27-05-2003 19:12

Euh, je n'ai pas tout suivi, au début, il calcule pour genome@home mais maintenant, il calcule folding@home je crois..... ? pourtant je n'ai pas touché ce progs depuis le début non stop. (genre il calcule 120 000 / 500 000)

Cougar 27-05-2003 19:26

Ton client.cfg se présente comme ça (à ouvrir avec le bloc note) :
Code:

[settings]
username=NDFRCougar
team=704901201
asknet=no
machineid=1
local=49

[http]
active=no
host=localhost
port=8080
usereg=yes
usepasswd=yes

[clienttype]
type=2

[core]
priority=96
cpuusage=100
disableassembly=no
ignoredeadlines=no

vérifie que t'es bien 2 en face de type.
si c'est pas le cas, met le :)

DelfinO 27-05-2003 19:52

oulà, c tout completement différents :

[settings]
username=DelfinO
team=704901201
asknet=no
machineid=1
local=8

[http]
active=no
host=localhost
port=8080
usereg=no

DelfinO 27-05-2003 19:57

Je vous montre mes historiques :

Voici le derniere changement automatique genome vers folding....

[22:39:27] [SPG] Writing current.xyz
[22:39:27] [SPG] Sequence 30 completed:
[22:39:27] NLVAIWPYQAPTSNTLGYPSGFIMVPLNPNVGPYLYTWDPATGTKGAVPW . . .
[22:39:27] Iterations: 600 of 600
[22:39:28] Finished
[22:39:29] [SPG] Design complete
[22:39:29] [SPG] completed successfully
[22:39:29]
[22:39:29] Finished Work Unit
[22:39:29] work_hdr.len_arcfile: 112200
[22:39:30] Leaving Run
[22:39:32] - Writing 112712 bytes of core data to disk.
[22:39:32] end (WriteWorkResults)
[22:39:32] - Shutting down core
[22:39:32]
[22:39:32] Folding@Home2 Protein Design Core Shutdown: FINISHED_UNIT
[22:39:32] Left some temporary files
[22:39:35] CoreStatus = 64 (100)
[22:39:35] Sending work to server


[22:39:35] + Attempting to send results
[22:39:44] + Results successfully sent
[22:39:44] Thank you for your contribution to Folding@home.
[22:39:44] + Number of Units Completed: 7
[22:39:48] + Attempting to get work packet
[22:39:48] - Connecting to assignment server
[22:39:49] - Successful: assigned to (171.64.122.144).
[22:39:49] + News From Folding@Home: Welcome to Folding@Home
[22:39:49] Loaded queue successfully.
[22:40:02] + Closed connections
[22:40:02]
[22:40:02] + Processing work unit
[22:40:02] Core required: FahCore_78.exe
[22:40:02] Core not found.
[22:40:02] - Core is not present or corrupted.
[22:40:02] - Attempting to download new core...
[22:40:02] + Downloading new core: FahCore_78.exe
[22:40:04] + 10240 bytes downloaded
... downloading
[22:40:16] + 603591 bytes downloaded
[22:40:16] Verifying core Core_78.fah...
[22:40:16] Signature is VALID
[22:40:16] Created: Wednesday April 10, 2002 00:01:22 UTC
[22:40:16] Signed: Thursday April 3, 2003 00:01:22 UTC
[22:40:16]
[22:40:16] Trying to unzip core FahCore_78.exe
[22:40:16] Decompressed FahCore_78.exe (1728512 bytes) successfully
[22:40:16] + Core successfully engaged
[22:40:21]
[22:40:21] + Processing work unit
[22:40:21] Core required: FahCore_78.exe
[22:40:21] Core found.
[22:40:21] Working on Unit 08 [May 26 22:40:21]
[22:40:21] + Working ...
[22:40:21]
[22:40:21] *------------------------------*
[22:40:21] Folding@home Gromacs Core
[22:40:21] Version 1.48 (May 7, 2003)
[22:40:21]
[22:40:21] Preparing to commence simulation
[22:40:21] - Looking at optimizations...
[22:40:21] - Created dyn
[22:40:21] - Files status OK
[22:40:22] - Expanded 510614 -> 2524929 (decompressed 494.4 percent)
[22:40:22] - Starting from initial work packet
[22:40:22]
[22:40:22] Project: 909 (Run 41, Clone 86, Gen 1)
[22:40:22]
[22:40:22] Assembly optimizations on if available.
[22:40:22] Entering M.D.
[22:40:28] Protein: p909_vill_str0
[22:40:28]
[22:40:28] Writing local files
[22:40:30] Extra 3DNow boost OK.
[22:40:32] Writing local files
[22:40:32] Completed 0 out of 250000 steps (0)
[22:48:32] Writing local files
[22:48:32] Completed 2500 out of 250000 steps (1)



Voilà qu'en pensez vous ?

Cougar 27-05-2003 19:59

bah tu peux mettre tout comme moi (sauf l'username bien sur)

"Quand tu lances pour la preières fois FAHConsole.exe tu remplies les informations...puis quand il te demande de configurer les "advanced option" tu met yes, et là tu mettras gah quand t'auras le choix entre gah/fah/nopref. "

Ou tu peux modifier dès maintenant le client.cfg à la main, au ipre si ça marche toujours pas du supprimes tous les fichiers sauf fahconsole.exe :)

jvais ptet faire un prog permettant de corriger ça, histoire de m'occuper un peu ;)

DelfinO 27-05-2003 20:07

D'accord mais pourquoi il change le programme genome en folding tout seul....

t'as regardé, c bien çà folding@home alors ? si oui je vais fermer et relancer.

Cougar 27-05-2003 21:18

bah pasque pendant l'installation, t'as pas spécifié les "advenced options", du coups le programme fait soit du genome, soit du folding, si par contre tu précises fah (type=2) il ne fera QUE du genome :)

D'après tes logs tu faisais du folding :)

mialin 28-05-2003 22:24

bonjour de mialin

streets 08-02-2004 00:06

Re: Venez Genomiser avec nous !
 
Ba ca fait longtemps qui'il est down ce topic

Alors up avec la version 4 de Folding@Home qui est sortit je ne sais quand d'ailleur . . . :rolleyes:
Allez voir par ici si ca vous dit :D


All times are GMT +2. The time now is 06:28.

Powered by vBulletin® Version 3.8.4
Copyright ©2000 - 2025, Jelsoft Enterprises Ltd.