NDFR : Venez Genomiser avec nous !
Vous avez une news à nous proposer ? Ecrivez-la et devenez rédacteur sur NDFR !

Actualité informatique

  • Commentaires
  • Ajouter un commentaire
  • Format imprimable
  • Envoyer par email

Pendant la longue période d'inactivité de NDFR, Enzo nous a fait découvrir Gen@Home. Ce programme fonctionne comme Seti. C'est-à-dire qu'il va chercher des données à calculer sur un serveur.

Vous aurez bien plus d'informations sur Gene@Home Alliance Francophone.

Le programme fonctionne dans une fenêtre de type DOS et il est disponible pour presque tous les OS. À noter qu'il est possible de trouver des GUI (interfaces graphiques pour le profane), mais personnellement la fenêtre DOS me convient. La charge processeur du programme client est tout le temps à 100% en priorité basse ce qui vous permettra de jouer, graver, écouter de la musique, surfer, etc...

Pour l'installer, rendez-vous sur cette page et enregistrez-vous.

Ensuite renseignez le programme avec votre nom d'utilisateur qui est celui avec lequel vous vous êtes inscrit au moment du téléchargement.

Le numéro de l'équipe :

Saisissez 704901201 pour NewdimensionFR (Gen@Home)

ou

Saisissez 31922 pour NewdimensionFR (Folding@Home)

Attention : Pour les nouveaux et les anciens vous avez ou vous devrez télécharger la version 3.24 du client Folding@Home. Il faudra donc faire très attention lors du paramétrage car il faut préciser que vous faites du genome (le N° d'équipe est toujours le même 704901201). Votre nom d'utilisateur devra avoir la même orthographe qu'avec l'ancien client sinon des doublons seront créés dans les statistiques...

Voici un exemple du fichier de config "client.cfg" qui peut être édité avec le bloc-notes :

Citation:
[settings]
username=Votre nom d'utilisateur
team=704901201
asknet=no
machineid=1
local=19

[http]
active=no
host=localhost
port=8080
usereg=no
usepasswd=yes

[clienttype]
type=2

[core]
priority=0
cpuusage=100
disableassembly=no
ignoredeadlines=no
A noter que l'aide pour la version console qui est fortement conseillée se trouve ici.

Quelques liens :

- Classement des équipes.
- Notre équipe (pour le moment 28 membres).
- Gene@Home Alliance Francophone (explications en français et liens vers des utilitaires GUI etc..).
- Statistiques détaillées des équipes.
- Statistiques détaillées de NDFR (MAJ toute les 12H).
- Statistiques détaillées de NDFR par Gingko, membre de l'équipe Alliance francophone.
- Encore des statistiques

Si vous êtes inscrit dans notre équipe, merci de nous donner la puissance cumulée des machines sur lesquelles vous avez installé le client Gen@Home

Récapitulatif de la puissance de calcule :

Formatman - 11 630 MHz
Blax - 8 650 MHz
NDFRCougar - 1600 MHz
highlander NDFR - 3 430 MHz
M a l a - 4 867MHz
Junta - 2 200 MHz
nonoghost - 2 000 MHz
streets - 5 500 MHz
Aymeric - 866 MHz
Beclaude - 2 400 MHz
Evasan - 1 470 MHz
NDFR Benjy - 1 800 MHz
jogo - 1 747 MHz
MattXSFR - 2 894 MHz
Zenophron - 1 470 MHz
Alex - 3 060 MHz
enzo19 - 1 700 MHz
jhack - 2 100 MHz
Spycam100 - 1330 MHz
Stan38 - 4300 MHz
DelfinO - 1667 MHz
mialin - 1000 MHz
zyk
Mercury
Naimbus93
endykun
Kalmeque
NeoFantome
Aiolizator

Total : 67 415 MHz

Note : il y en a que je n'arrive pas à reconnaître d'après leur pseudo

Mis à jour le 13 JUIN 2003 à 18H10
  • BlinkList
  • Bookmarks
  • del.icio.us
  • Digg it!
  • Facebook
  • Furl
  • Fuzz
  • Google
  • Mikiwi
  • Mister Wong
  • MySpace
  • Newsvine
  • Nuouz
  • reddit
  • Scoopéo
  • Spurl.net
  • StumbleUpon
  • Technorati
  • Twitter
  • Wikio
  • Yahoo! Bookmarks
  • Yahoo! Myweb

367 commentaires pour “Venez Genomiser avec nous !”

  1. enzo19 a dit (le 11 février 2003 à 10h17)
    lol Merci ! Je veux participer !

    Bon aller ! Courage et essayer de rattraper mon équipe
  2. Werner a dit (le 11 février 2003 à 11h04)
    ça risque d'être dur de vous battre lol enfin pour l'instant car nous ne somme que 4
  3. LeMoi a dit (le 11 février 2003 à 14h21)
    euh, j'ai pas trop compris à koi ça sert ... :confused:
  4. Cougar a dit (le 11 février 2003 à 14h26)
    "L'un des meilleurs moyens d'y parvenir est d'étudier les autres génomes et les séquences de gènes individuels qui sont déjà disponibles. En comprenant comment fonctionnent ces génomes, nous pourrons mettre ce vaste volume de données (plus de 50.000 gènes et 3 milliards de paires de bases de nucléotides) dans une perspective biologique et médicale, lui donnant ainsi tout son sens. "

    en gros c'est comme le Décryphton and co, ça étudie les gênes, protéines et mollécules du vivant pour trouver des térapies géniques etc...
  5. LeMoi a dit (le 11 février 2003 à 14h29)
    d'acord, je vais essayer !
  6. Werner a dit (le 11 février 2003 à 15h32)
    Cool une nouvelle recrue
  7. dd54fr a dit (le 11 février 2003 à 17h54)
    Salut, je suis actuellement sur la Tean Alliance Francophone #492900610:
    comment passer sur votre compte en transferant mes 1102 gènes?
  8. Cougar a dit (le 11 février 2003 à 18h58)
    et bien tout simplement dans le ghclient.cfg en changeant le numéro 492900610 par 704901201 ( en laissant les autres caractères).

    Par contre je crois que tes 1102 gênes resteront chez Tean Alliance et donc que tu recommenceras de 0 (seulement dans les stats de notre team).
  9. highlander a dit (le 11 février 2003 à 19h18)
    Ou est-ce que je peut trouver l'interfarce graphique de Gen@Home SVP
  10. Werner a dit (le 11 février 2003 à 19h22)
    Bienvenue dd54fr ne m'en veut pas mais j'ai modifié ta signature et surtout ta configuration dans ton profil car ça décallait tes messages Le mieux serait de mettre ta plus grosse config

    Sinon je prépare un envois Gene@Home ce soir et j'ai rajouté quelques MHz pour nous aider

    - 10 X PIII 450MHz
    - 2 X PIII 500MHz
    - 1 X PIII 1260MHz (c'est un serveur bi CPU à la base mais bon faut pas abuser )
    - 1 X 2260MHz
    - 1 X 3060MHz

    Total 12 080 MHz

    Highlander tu en as une de dispo chez http://genome.dwchat.net section téléchargement... il y en a d'autre sur le net
  11. highlander a dit (le 11 février 2003 à 19h36)
    Voila je me suis inscrit dans la team NDFR
    Donc un de plus
  12. Cougar a dit (le 11 février 2003 à 19h37)
    Je propose de comptabiliser en bas du message principale la puissance de calcul de chacun, ou de faire un truc de stats qui sera plus ergonomique
  13. BeClaude a dit (le 11 février 2003 à 20h14)
    Salut à tous,

    Ce que j'apprecie le plus dans ce programme mise a part que c'est pour la bonne cause.

    C'est que l'ont sens pas tourner aucun ralentissement du system c'est vraiment extrat
  14. ChatNoir a dit (le 11 février 2003 à 20h19)
    Perso, je participe à un projet similaire depuis septembre 2001.

    C'est United Devices. Le but : la rercherche contre le cancer en association avec l'université d'Oxford, Intel et IBM. J'avais essayé le truc du telethon, mais il bouffait des ressources aux autres programmes. Celui là est discret.
    Donc, désolé de ne pas rejoindre votre "groupe" mais bon, j'ai mes petites habitudes et mon CPU mouline dejà. (pis c'est pas une pauvre interface DOS )

    En passant, je suis bien content de la réouverture du Forum.
  15. LeMoi a dit (le 11 février 2003 à 21h06)
    Citation:
    Provient du message de Formatman
    Cool une nouvelle recrue
    dsl en fait mon pc n'est pas allumé en permanence , je pourrais pas trop vous aider
  16. Werner a dit (le 11 février 2003 à 21h10)
    Je participais aussi à United Devices au début avec Matt. Il parait que c'est un peu trop "privé", mais bon de toute façon je trouve ça très bien de participer à ce type de projet surtout que nos CPU sont souvent sous exploités lors de l'utilisation de notre PC.
  17. enzo19 a dit (le 11 février 2003 à 21h30)
    LeMoi, pas besoin d'avoir son pc ki tourne en permanence, ta venue sera appréciée
  18. claude922 a dit (le 11 février 2003 à 22h28)
    Cool ce "projet" si on peut appeler cela comme ça!

    Je veux vous aidez dans votre team, mais je réussi pas à installer le logiciel sous Win2000... Je lance l'installation je vois un screen, ça disparait et puis ça ne reviens plus et plus rien!
    Qu'est-ce que je dois faire ?
  19. Cougar a dit (le 11 février 2003 à 22h43)
    j'ai eu le même problème, jvais t'envoyer le soft déjà installé, t'auras plus qu'à le décompresser et à éxécuter ghclient.exe

    http://perso.wanadoo.fr/ndfr/Genome@home.ace

    merci à Enzo
  20. claude922 a dit (le 11 février 2003 à 22h50)
    Merci!
  21. claude922 a dit (le 11 février 2003 à 22h53)
    Marche pas ton lien coug...
  22. Junta_ a dit (le 11 février 2003 à 23h02)
    +1 dans la team ndfr avec +1203 mhz
  23. Cougar a dit (le 11 février 2003 à 23h03)
    wanadoo doit pas aimer les .ace

    http://perso.wanadoo.fr/ndfr/genome.zip

    ça marchera mieux
  24. Werner a dit (le 11 février 2003 à 23h15)
    Citation:
    Provient du message de Junta_
    +1 dans la team ndfr avec +1203 mhz
    Cool merci aussi a Aymeric, Mercury et Kalmeque qui ne sont apparemment pas membres du forum
  25. nonoghost a dit (le 12 février 2003 à 02h06)
    Salut à tous,

    Je me suis inscris pour la Team de NDFR, j'utilise la config décrite a gauche

    Je laisse tourner 24/24 et vais voir les scores qu'il est possible de réaliser...

    Tchuss @ all,

    Nono.
  26. highlander a dit (le 12 février 2003 à 02h46)
    hum une question:
    Je me suis inscrit dans la team NDFR et je ne me vois pas dans la liste http://www.statsman.org/genomestats/html/4859.html
    Pourquoi ?
  27. Cougar a dit (le 12 février 2003 à 08h14)
    Citation:
    Provient du message de highlander
    hum une question:
    Je me suis inscrit dans la team NDFR et je ne me vois pas dans la liste http://www.statsman.org/genomestats/html/4859.html
    Pourquoi ?
    tu seras dans la liste après avoir envoyé ton premier résultat
    (donc calculer les premières 30 séquences).
  28. enzo19 a dit (le 12 février 2003 à 09h39)
    Exactement : sans envoie de résultat, tu ne peux pas apparaitre dans la liste des membres.

    Genomiseur Professionnel
  29. Spycam a dit (le 12 février 2003 à 14h08)
    C koi la différence entre Gen@Home et Folding@home ?
  30. Werner a dit (le 12 février 2003 à 16h30)
    Citation:
    Folding@home, s'efforce de comprendre comment les protéines existantes atteignent leurs structures fonctionnelles spécifiques à trois dimensions.

    Le but de Genome@home est de dessiner de nouveaux gènes pouvant coder des protéines opérationnelles au sein de la cellule. Genome@home utilise un algorithme informatique...
    Folding@home possède un client avec une GUI d'origine et ne recherche pas la même chose que Genome@home. Pour l'instant, nous sommes concentrés sur ce dernier...
  31. matt-fly a dit (le 12 février 2003 à 20h15)
    Apparement personne du cote FreeBSD ne connait ce truk, donc je vais le porter et le soumettre des ce soir a FreeBSD Je le fait tourner actuellement sous FreeBSD 5.0 sans aucuns soucis donc ca devrait aller

    ie,
    je viens de terminer 3 sequence sous freebe alors que sous win ca commence juste la 2eme, pourtant les box sont kif kif pareil, certaines sequences sont donc beaucoup plus hard que d'autres ?
  32. Werner a dit (le 12 février 2003 à 21h29)
    Citation:
    Provient du message de Blax`
    je viens de terminer 3 sequence sous freebe alors que sous win ca commence juste la 2eme, pourtant les box sont kif kif pareil, certaines sequences sont donc beaucoup plus hard que d'autres ?
    Apparement oui il y a des séquences plus lourdes que d'autres car sur 7 PC identiques il y en a certains qui mettent bcp moins de temps.
  33. Werner a dit (le 13 février 2003 à 20h13)
    Petit résumé :

    Nous sommes maintenant 596ème et nous avons 11 membres que je remercie pour leur participation au projet. Même si vous envoyez peu de résultat ce n'est pas trop grâve car l'important c'est de participer

    Pour ma part je ferai un "big" envois demain soir

    Récapitulatif de la puissance de calcule :

    Formatman 12 080 MHz
    Cougar 2 800 MHz
    endykun ?
    Blax 8 650 MHz
    Kalmeque ?
    NeoFantome ?
    nonoghost 2 000 MHz
    Aymeric 866 MHz
    beclaude 1 000 MHz
    Mercury ?
    highlander_NDFR 3 430 MHz
    Mala 1 200 MHz
    jogo@tiscali.fr 1 747 MHz

    Total : 33 773 MHz

    Note : il y en a que je n'arrive pas à reconnaître d'après leur pseudo
  34. matt-fly a dit (le 13 février 2003 à 20h39)
    si tu te base sur le Config du forum, alors c'est pas bon
    en ce qui me concerne il y a 3 PIV de: 2260 MHZ, 2400 Mhz et 2660 Mhz et peut etre un T.Bird 1433 Mhz pour bientot

    ce qui nous fait donc 26 866 Mhz sure et 28299 Mhz a venir.
  35. Werner a dit (le 13 février 2003 à 20h50)
    Oki c'est à jour Tu as sorti l'artillerie lourde
  36. rog62 a dit (le 13 février 2003 à 21h09)
    Citation:
    Provient du message de Blax`
    si tu te base sur le Config du forum, alors c'est pas bon
    en ce qui me concerne il y a 3 PIV de: 2260 MHZ, 2400 Mhz et 2660 Mhz et peut etre un T.Bird 1433 Mhz pour bientot

    ce qui nous fait donc 26 866 Mhz sure et 28299 Mhz a venir.
    Format, es-tu certain que Blax ne voulait pas dire qu'il ajoutait 2260+2400+2660=7320 à ton total (19546) et que cela donnait (tout compris pour le team) 26866

    Autrement dit, je ne suis pas certain que Blax possède 9 PIV ...
  37. matt-fly a dit (le 13 février 2003 à 21h19)
    hey tu t'emballe Format
    le 26 866 c'est le total de la team, pas de moi, t'es fou fou j'ai juste rajouter a la somme que tu avais indique
  38. Werner a dit (le 13 février 2003 à 21h59)
    lol désolé les gars je me suis vraiment emporté :confused:

    Bon voilà c'est de nouveau à jour
  39. nonoghost a dit (le 14 février 2003 à 00h47)
    Citation:
    Provient du message de Formatman
    ... 596ème et nous avons 11 membres que je remercie pour leur participation au projet. Même si vous envoyez peu de résultat ce n'est pas trop grâve car l'important c'est de participer

    Récapitulatif de la puissance de calcule :

    Formatman 12 080 MHz
    Cougar 2 800 MHz
    endykun ?
    Blax 7 320 MHz
    Kalmeque ?
    NeoFantome ?
    nonoghost 2 000 MHz
    Aymeric 866 MHz
    beclaude 1 000 MHz
    Mercury ?
    highlander_NDFR 800 MHz

    Total : 26 866 MHz....
    Format,
    Tu as 12,08 Ghz ??? En 1 seule machine ??? :eek:

    T'es pas un blagueur !!! :bandit:
  40. matt-fly a dit (le 14 février 2003 à 00h59)
    Citation:
    Sinon je prépare un envois Gene@Home ce soir et j'ai rajouté quelques MHz pour nous aider

    - 10 X PIII 450MHz
    - 2 X PIII 500MHz
    - 1 X PIII 1260MHz (c'est un serveur bi CPU à la base mais bon faut pas abuser )
    - 1 X 2260MHz
    - 1 X 3060MHz

    Total 12 080 MHz
    page1, ceci explique cela
  41. Werner a dit (le 14 février 2003 à 08h31)
    Mon rêve une machine à 12 GHz Je ne l'ai pas installé sur tous les postes et serveurs car ils sont sollicités
  42. matt-fly a dit (le 14 février 2003 à 13h00)
    voila, je viens de rajouter un t.bird de 1330 Mhz en fait, ce qui nous fait un total pour la team de 28 196 Mhz
  43. rog62 a dit (le 14 février 2003 à 13h25)
    Citation:
    Provient du message de Blax`
    voila, je viens de rajouter un t.bird de 1330 Mhz en fait, ce qui nous fait un total pour la team de 28 196 Mhz
    Attention Format, ce n'est pas 28 196 Mhz en plus...
  44. Werner a dit (le 14 février 2003 à 14h13)
    c'est mis à jour
  45. enzo19 a dit (le 14 février 2003 à 15h48)
    Citation:
    Provient du message de Formatman
    Apparement oui il y a des séquences plus lourdes que d'autres car sur 7 PC identiques il y en a certains qui mettent bcp moins de temps.
    C'est exactement ca. Certainement séquence sont rapide et n'envoie presque aucune unité, alors que les plus longues... rapportes bcp de wu.

    La plus grosse séquences m'avait rapporté (à mes débuts) 174 wu si je ne m'abuse... mais je vous raconte pas le temps de calcul :confused:
  46. Werner a dit (le 14 février 2003 à 19h28)
    J'imagine le temps que ça a du prendre :eek: Il y a une chose que je reproche à tous ces programmes c'est qu'on ne peut pas se servir de la puissance de plusieurs machines pour un seul calcule.
  47. highlander a dit (le 14 février 2003 à 20h15)
    Ajout d'un PIV 2630 Mhz en plus de mon PIII 800 Mhz

    Ce qui fait 2630+800=3430 Mhz
  48. Cougar a dit (le 14 février 2003 à 20h29)
    Citation:
    Provient du message de Formatman
    J'imagine le temps que ça a du prendre :eek: Il y a une chose que je reproche à tous ces programmes c'est qu'on ne peut pas se servir de la puissance de plusieurs machines pour un seul calcule.
    Dis donc, tu crois pas que c'est le principe du calcul distribué ?

    Puis imagine s'il fallait échanger les résultats/calculs entre chaques machines, ça prendrait un temps énorme!

    Par exemple pour Genome, 1000 machines travaillent sur un gêne précis mais 1000 machines ne travailles pas su :eek:
  49. Spycam a dit (le 14 février 2003 à 20h30)
    Vous êtes sur ke Genome@home est une entreprise fiable ?
    Ke le log sert vraiment à "dessiner de nouveaux gènes pouvant coder des protéines opérationnelles au sein de la cellule" ?
    Et pas créer des protéine d'anthrax ( ou autre ) 8-[]?
    çà pe paraïtre 1 pe parano mé il fo se poser la question.
  50. Cougar a dit (le 14 février 2003 à 20h36)
    je crois pas qu'ils se risqueraient à faire transiter leur données (gênes étudiés,résultats,...) sur le net si ça constituait un secret militaire et/ou une menace.
  51. Mala a dit (le 14 février 2003 à 21h14)
    Bon ben j'ai ajouté mes 1.2 Ghz à la Team mais c'est biz je me vois po dans la liste sur la page des stats !
  52. Cougar a dit (le 14 février 2003 à 21h16)
    Citation:
    Provient du message de Mala
    Bon ben j'ai ajouté mes 1.2 Ghz à la Team mais c'est biz je me vois po dans la liste sur la page des stats !
    faut que t'envoies au moins un résultat
  53. Werner a dit (le 14 février 2003 à 22h24)
    En parlant de résultats j'en ai envoyé 16 vers 18H00 et la fiche n'est toujours pas à jour... c'est grâve docteur

    Cougar on peut faire des clusters si le logiciel le permet, mais apparemment ce n'est pas le cas des logs de calcul distribués.

    La liste a été de nouveau mise à jour
  54. Cougar a dit (le 14 février 2003 à 22h28)
    Citation:
    Provient du message de Formatman

    Cougar on peut faire des clusters si le logiciel le permet mais apparement ce n'est pas le cas des logs de calcul distribués.

    ouais mais ça divise un calcul en plusieurs sous calculs , donc c'est X PC qui calculent pour un unique résultat final mais qui ne calcule pas la même chose
  55. highlander a dit (le 15 février 2003 à 17h13)
    Je viens de trouver une interface graphique Genome Spy

    Lien direct pour les flemmards ICI
  56. Werner a dit (le 15 février 2003 à 17h58)
    Je l'utilise pour mes postes en réseaux sinon vous avez GSpy (photo de l'interface ci-dessous).


    Lien direct http://www.teamsoup.org/downloads/GSpy-SFX.exe
  57. highlander a dit (le 16 février 2003 à 01h43)
    Ce qui serait bien c'est que qqun traduise ce soft "Genome Spy"
  58. enzo19 a dit (le 16 février 2003 à 09h46)
    Vas-y ! On attend ta version highlander
  59. Werner a dit (le 20 février 2003 à 20h48)
    Salut les Genomaniaques ^^ Je viens de recevoir un mail de Bile qui aimerait que l'on se joigne à son équipe. Évidemment, la décision est dure à prendre et ça serait dommage de perdre tout le boulot que l'on a fourni depuis le début dans l'équipe NDFR. Ci dessous vous trouverez le copier/coller du mail... J'attends donc d'avoir votre avis sur ce que nous devons faire tous ensemble.

    Citation:
    Bonjour,

    Je viens de m'appercevoir dans le classment de Stanford que nos 2 teams étaient très proches et toutes les 2 sont très récentes. Je m'occupe du team Projet100k qui rassemble une partie de la communauté eDonkey.

    Le projet100k est à la base un projet qui réunissait cette communauté dans le but de monter le plus gros serveur eDonkey du monde. Celui-ci est sur le point d'être réalisé.

    Je me permets de vous écrire pour vous faire une proposition. Pourquoi ne pas rejoindre notre team afin d'essayer ensemble de rejoindre au classement la team Alliance Francophone et pk pas un jour les dépasser .

    J'ai déjà rassemblé en 7 jours plus de 100 personnes et je compte encore en trouver 100 environ. Ce qui ferait de notre team une des plus fortes. Au classment du nombre d'unités transmises le 19.2.3 on était 8ème et votre team environ 24ème. Ensemble nous serions 6ème avec une grande chance d'arriver 4ème.

    Je suis en train de contacter les sites web qui nous ont soutenu dans le cadre du projet 100k. Plus d'infos ici :
    http://81.91.66.90/ed2kch/projet100k/

    Notre message c'est : les users de p2p ne sont pas uniquement là pour s'échanger des fichiers sur le net, ils donnent également ce qui ne s'échange pas... la vie, du moins ils y contribuent.

    Je suis à votre disposition pour en parler sur :
    msn
    icq

    A+
    bile
  60. BeClaude a dit (le 20 février 2003 à 23h29)
    Salut a tous,

    La proposition de Bile est sympathique
    Mais perso je preferre rester dans l'équipe NDFR
    Car je lutte pas contre une autres equipe "comme dans un jeux" je fait juste de participer et j'aime bien NDFR.

    Mais la proposition de Bile est très sympas
  61. matt-fly a dit (le 21 février 2003 à 07h33)
    perso je bouge pas d'ou je suis
    comme dit BeClaud, c'est pas pour moi un concours, et j'ai plus tendence a regarder en profondeur les nouveaux resultats plutot qu'autre chose (me suis fait un petit tableau pour pas etre perdu), donc je reste
  62. Werner a dit (le 21 février 2003 à 08h19)
    Bon pour l'instant j'ai votre avis + Cougar, Benjy, Aymeric et moi donc je vais lui dire que pour l'instant nous préférons être indépendant. Au pire s'il y en a qui veulent rejoindre l'équipe Projet 100K, vous trouverez leur numéro dans le classement par équipe
  63. bile666 a dit (le 21 février 2003 à 11h32)
    Bonjour,

    Comme vous l'avez certainement remarqué, c'est moi qui est adressé cette proposition à votre team.

    Je vous comprends tout à fait et je vous remercie de m'avoir répondu si rapidement.

    Je voulais juste préciser quelque chose, c'est bien l'aspect scientifique qui nous a motivé à choisir Genome comme système de calculs partagés. Par contre je ne néglige pas l'aspect concurence et course poursuite entre teams. Car tous les users ne sont pas motiviés par les aspects scientifiques et tous ces users comptent également à mes yeux, même si certains n'ont calculé qu'un jour, c'est toujours un gêne de gagner pour la science et pour le team.

    Le résultat de notre équipe est d'ailleurs le reflet de cet esprit :
    en 8 jours nous avons rassemblé 128 personnes et sommes monté au 254ème rang mondial. Nous avons envoyé près de 3'700 unités hier, ce qui nous a mis au 6ème rang mondial pour la journée du 21.2.02. Avec votre soutien, nous serions arrivé 4ème avec que 2000 unités de moins que l'Alliance Francophone qui était 3ème.

    Mais j'avoue avoir le meme problème que vous, je ne pourrai pas changer de team facilement, surtout qu'elle porte le nom d'un très grand projet que je mène actuellement et qui a nécessité un formidable effort de la communauté francophone d'eDonkey.

    J'espère que l'on gardera contact et je manquerai pas de parcourir votre site de temps en temps.
  64. matt-fly a dit (le 21 février 2003 à 15h08)
    ok, si je trouve d'autres pc, j'irai me joindre a vous en tant que Blax2
  65. llaumgui a dit (le 21 février 2003 à 15h49)
    Se genre de truc, ça bouffe pas toute tes ressources? eMule + ça + 800MHz ça passe???
  66. Werner a dit (le 21 février 2003 à 16h16)
    Oui ça passe la machine de mon frère fait eMule + Gen@Home + gravure + surf en simultané avec un 866 MHz
  67. Cougar a dit (le 21 février 2003 à 19h52)
    le Genome s'adapte à ton utilisation, tu peux même lancer un jeu ou un DVD, le soft réduirat automatiquement les ressources qu'il prend
  68. bile666 a dit (le 21 février 2003 à 21h01)
    Citation:
    Provient du message de llaumgui
    Se genre de truc, ça bouffe pas toute tes ressources? eMule + ça + 800MHz ça passe???
    Je vois qu'on t'a très bien répondu à ta question. Je rajouterai que j'utilise g@h + emule + surf sur un pII 300 avec 128mb et xp

    Ca passe nickel.
  69. BeClaude a dit (le 21 février 2003 à 22h46)
    Salut a tous,

    Bile666 en tout cas je te souhaite la bienvenue parmis nous

    Ps: tu peux me passer les codes de sion je suis impatient de voir Matrix II & III
  70. streets a dit (le 22 février 2003 à 11h36)
    kikoo tous le monde

    ca fait une semaine que je "Genomise" ds la team ndfr
    faut dire que j'avais deja testé avant un projet au fonctinnement similaire UNITED DEVICES mais je devais le couper si je voulais profiter de mon pc (encodage video/son par ex).


    avec Genom@home pas de probleme donc si je peut me rendre utile . . . je verrais si je peut l'installer sur un autre PC avec le meme pseudo (c possible je pense)

    pour le moment je tien a dispo mes 800MHZ






    @+Steets alias TrueFiLX
  71. nonoghost a dit (le 22 février 2003 à 13h09)
    Hello Internet people,

    Pour ma part je ne genomise plus depuis environ 1 semaine car j'ai déménagé, mais c promis des que je recupere mon ADSL, je reviens en course...
  72. Matt a dit (le 22 février 2003 à 22h26)
    Format, tu peux ajouter 1x1690 MHz (au 2050 si tu tiens compte du PR d'AMD ...) + 1x790 + 1x448 ...
    Le premier qui me dit que mes CPU ont des fréquences bizarres, je le fusile

    PS : perso, je fait tourner Genome@Home et United Devices en simultané, mais même si les deux sont en priorité minimale, Genome@Home est à 100% et UD à 0% (idem si je remonte la priorité de UD). Si qq'un a une soluce, je suis preneur, parce que j'ai pas envie de lâcher UD pour l'instant (j'ai fondé une équipe ...)
  73. Werner a dit (le 22 février 2003 à 23h06)
    C'est mis à jour Matt
  74. Zenophron a dit (le 23 février 2003 à 00h20)
    Bonjour,

    je viens de m'inscrire à la Team,

    Vous disposez en plus de 1.47 GHz (Athlon XP 1700+).

    A plus.
  75. Zenophron a dit (le 23 février 2003 à 01h12)
    Citation:
    Arsenic à écrit :
    Cool ce "projet" si on peut appeler cela comme ça!

    Je veux vous aidez dans votre team, mais je réussi pas à installer le logiciel sous Win2000... Je lance l'installation je vois un screen, ça disparait et puis ça ne reviens plus et plus rien!
    Qu'est-ce que je dois faire ?
    Salut Arsenic,

    Il faut simplement que tu installes le prog en admin. Rien de plus simple...
  76. Matt a dit (le 23 février 2003 à 01h34)
    Déjà plus de 42 GHz ... A quand le THz ?
  77. streets a dit (le 23 février 2003 à 17h35)
    est ce que la version avec interface graphique permet de reduire genome@home dans la barre des taches?
    C srait mieux s je ve l'intaller sur un autre PC.
  78. Werner a dit (le 23 février 2003 à 21h48)
    J'utilise TrayIT pour ça (http://www.broadbandreports.com/faq/3795). Sinon tu peux mettre Genome@home en service avec FireDaemon...
  79. Matt a dit (le 24 février 2003 à 13h44)
    Thanxs pour FireDaemon ... Je me demandait justement comment me débarasser de cette p***** de fenêtre DOS

    PS : Si les autres admin du club info de mon bahut sont OK, je pourrais bientôt apporter quelques MHz supplémentaires : 200 MMX, PIII 450, Athlon 750, XP 2400+.
    Je te tiendrais au courant.
  80. Mala a dit (le 25 février 2003 à 00h28)
    Ajout d'un P4 1800 MHz pour moi DELL POWAAA
  81. Werner a dit (le 25 février 2003 à 00h47)
    C'est mis à jour merci Mala Je ne sais pas si vous avez remarqué, mais nous avons dépassé la team Microsoft
  82. highlander a dit (le 25 février 2003 à 00h59)
    Il n'y a pas de mal, ils sont inactifs regarde ici !
  83. Werner a dit (le 25 février 2003 à 11h49)
    Je me disais aussi que c'était étrange
  84. Alexlesioux a dit (le 25 février 2003 à 16h01)
    Je m'inscris ce soir si j'ai le temps
  85. Matt a dit (le 26 février 2003 à 13h12)
    Est ce que quelqu'un sait comment faire pour télécharger des packs de calculs à l'avance pour pouvoir faire génomiser un PII 448 pendant une semaine ou deux sans connction Internet (j'aimerais récupérer les packs, les mettre sur CD et les transférer sur le PII, puis faire la manip inverse avec les résultats vu qu'il a pas de connection)
  86. Werner a dit (le 26 février 2003 à 13h19)
    Tu fais une deuxième install dans un autre répertoire sur ton poste qui a Internet. Ensuite tu lances le genome pour qu'il aille récupérer les données. Tu fermes la fenêtre pdt le filtrage et tu copies le répertoire complet sur tes postes qui n'ont pas Internet via le réseau ou un support (disquette, zip, CD-R etc...).

    Ensuite il suffira de faire un raccourci avec la commande -nonet sur les PC qui n'ont pas Internet.

    Paramètres du raccourci :

    Cible = "C:\Program Files\Genome@home\ghclient.exe" -nonet

    Démarre dans = "C:\Program Files\Genome@home"
  87. Matt a dit (le 26 février 2003 à 13h47)
    OK. Et donc ensuite, je recommence ça autant de fois que nécessaire pour avoir une bonne réserve de taf pour la semaine ?
  88. Werner a dit (le 26 février 2003 à 14h50)
    Oui tu fais ça sur chaque PC et au bout des 30 séquences il revient à 1 et génère au fure et à mesure 3 fichiers.

    Par exemple :

    - csum.238849
    - output.chi.238849
    - str.238849

    Pour faire un envoi groupé, tu prends tous les résultats sur chaque PC et tu les mets dans le dossier Genome@home du PC qui a Internet. Au prochain redémarrage du programme, il les uploadera tout seul.

    Par contre, garde une copie des fichiers, car après ils sont effacés et lors de gros envois, il arrive qu'ils ne soient pas pris en compte... il faut donc les réuploader plusieurs fois
  89. Matt a dit (le 26 février 2003 à 14h54)
    OK je vais essayer ça. Merci.
  90. streets a dit (le 2 mars 2003 à 00h23)
    Citation:
    Provient du message de Formatman
    J'utilise TrayIT pour ça (http://www.broadbandreports.com/faq/3795). Sinon tu peux mettre Genome@home en service avec FireDaemon...
    marche po tray it p-e avec la version avec Interface graphique
    je confirmerai ça demain
  91. streets a dit (le 2 mars 2003 à 23h45)
    euh . . .comment on fait pour configurer gspy
    il faut installer Genome version dos avant?
  92. Werner a dit (le 2 mars 2003 à 23h49)
    Oui et en fait ça n'est pas configurable tu vois juste ce qui se passe D'ailleur il faut copier tout les fichiers gspy dans genome sinon ça ne fonctionne pas...
  93. streets a dit (le 3 mars 2003 à 00h01)
    ok parce que tray it ne fontionne po sous xp avec genome@home
    et j'esite le metre dans les "service" sous xp
  94. Werner a dit (le 3 mars 2003 à 00h28)
    Je capte pas car chez moi sous XP ça tourne sinon il te reste à le mettre en service
  95. Werner a dit (le 3 mars 2003 à 17h09)
    Bon j'ai retiré quelques GHz à mon total car des postes doivent partir vers de nouvelles aventures ^^ Le miens est privé de Genome jusqu'à demain matin car le ventillateur arrière vient de tomber en rade et vu que c'est lui qu'il assure le refroidissement passif, le CPU grimpe à plus de 90 °C si je genomise

    Sinon Streets tu as installé le programme en service ?
  96. highlander a dit (le 4 mars 2003 à 19h38)
    Je sais pas si ça vous l'a déjà fait mais ça me met ça dans la fenêtre de G@H:

    Citation:
    Initializing protein design algorithm
    Designing protein sequence 6 of 30
    jwe0217i-e In ASIN(x) or ACOS(x), ABS(x).gt.1.0 (x=-0.100000012e+01).
    error occurs at ???????? loc 0044d8dd
    ???????? at loc 00000000 called from loc 0044caab in ????????
    ???????? at loc 00000000 called from loc 0043b3e6 in ????????
    ???????? at loc 00000000 called from loc 0045b09a in ????????
    ???????? at loc 00000000 called from loc 0041ed4d in ????????
    ???????? at loc 00000000 called from loc 00419c02 in ????????
    ???????? at loc 00000000 called from loc 00414e7f in ????????
    ???????? at loc 00000000 called from loc 0041d7a1 in ????????
    ???????? at loc 00000000 called from o.s.

    [????????] : Program name cannot be printed for not finding COFF symbols.

    taken to (standard) corrective action, execution continuing.
    10.0% 20.0%
    Est-ce que vous l'avez dèja eu ce truc ? Et qu'est-ce que ça veut dire (S'il y en a qui comprenne qqchose !! ) ?
  97. Werner a dit (le 4 mars 2003 à 19h47)
    Je l'ai déjà eu et je crois que c'est pas bon... à chaque fois je clic sur le raccourci "Clear bad work & restart".
  98. Matt a dit (le 9 mars 2003 à 17h40)
    Citation:
    Provient du message de Formatman
    le ventillateur arrière vient de tomber en rade et vu que c'est lui qu'il assure le refroidissement passif
    >> Faudra m'expliquer comment tu fait du refroidissement passif avec un ventilo
  99. Werner a dit (le 9 mars 2003 à 17h46)
    Bah avec un tunnel dans la tour. Je n'ai pas de ventillo sur le dissipateur donc tu appel ça comment un CPU avec aucun ventillo collé sur le dessus ou le côté ?


    C'est le ventillo que l'on voit en arrière plan qui est tombé en panne et il appartient au boîtier et non au CPU
  100. Matt a dit (le 9 mars 2003 à 18h31)
    bah c quand même pas du refroidissement passif ... refroidissement passif, c pas de ventilo du tout ...
  101. Werner a dit (le 9 mars 2003 à 18h33)
    bah c'est comme s'il n'y en avait pas vu que c'est celui du boîtier... vous n'avez pas de ventillo à l'arrière de vos boîtier ? Je vais quand même pas enlever les ventillos de la tour (remarque ça a tenu 24H sans ventillo) D'ailleur tous les autres passifs ils utilisent ce système de guidage d'air ou c'est étudié pour qu'il y est le ventillo de la tour juste derrière sinon ce serait impossible de faire tenir un CPU récent en pleine charge dans une tour non ventillé.

    Edit

    Sur les sites de hardware ils disent ça :

    un radiateur passif n'est qu'une plaque métallique avec de nombreuses ailettes, servant à diffuser la chaleur. Ce système, économique et silencieux, n'est efficace qu'avec des machines offrant une bonne circulation d'air. Ainsi, il est déconseillé de laisser le boîtier d'un PC ouvert, cela peut empêcher une circulation d'air forcée et provoquer une surchauffe.

    Donc il y a forcément un ventillo quelque part dans la tour sinon pas de circulation d'air :chinese:
  102. nonoghost a dit (le 9 mars 2003 à 19h21)
    Fo avouer que ca fait du+ bel effet quand meme
  103. Werner a dit (le 9 mars 2003 à 19h25)
    Merci nonoghost sinon pour en revenir au sujet, vous avez sans doute remarqué que le serveur de genome était down depuis hier... avez-vous réussi à envoyer des résultats ?
  104. highlander a dit (le 9 mars 2003 à 19h37)
    J'ai remarqué, mais j'espère que mes données ont été envoyée sinon je suis vert :angry:
  105. Cougar a dit (le 9 mars 2003 à 19h43)
    bah moi j'arrive à envoyer et a recevoir (en tous cas c'est ce qui est marqué dans ma fenêtre dos )
  106. Werner a dit (le 9 mars 2003 à 19h52)
    Effectivement moi aussi je reçois et je peux envoyer, mais je crois que je vais quand même attendre que ce soit rétabli pour faire un envoi groupir
  107. Matt a dit (le 10 mars 2003 à 15h22)
    Perso, j'ai envoyé des résultats, mais apparement c pas visible dans mes stats
  108. Werner a dit (le 10 mars 2003 à 15h34)
    Il faut faire attention, car des fois ce n'est pas pris en compte donc je rebalance 4 ou 5 fois l'envoi... surtout quand c'est du groupir
  109. Matt a dit (le 10 mars 2003 à 19h57)
    Oki. La prochaine fois j'enverrais plusieurs fois
  110. chalouf a dit (le 13 mars 2003 à 00h01)
    Excuse moi de m'incruster dans le sujet mais vous parler de quoi au juste ?
    :confused:
  111. rog62 a dit (le 13 mars 2003 à 00h19)
    Citation:
    Provient du message de chalouf
    Excuse moi de m'incruster dans le sujet mais vous parler de quoi au juste ?
    :confused:
    Cela commence ici et ensuite, il suffit de lire la suite des posts...
  112. Werner a dit (le 13 mars 2003 à 00h40)
    On vous attendait plus les gars "venez genomiser avec nous"

    Chalouf découvre ce sujet alors qu'il est présent depuis un mois
  113. enzo19 a dit (le 13 mars 2003 à 07h51)
    Citation:
    Provient du message de chalouf
    Excuse moi de m'incruster dans le sujet mais vous parler de quoi au juste ?
    :confused:
    lol C'est vraiment trop fort là Chalouf... arrête ta course au nombre de post et lit ce à koi tu répond
  114. chalouf a dit (le 13 mars 2003 à 17h39)
    Excuse moi Rog je pense que c'est toi qui fait la course a la poste tu as posté 40 messages en memes pas une nuit.
    Alors avant de dire n'importe quoi refléchis un peu.

    Mes amities!
  115. Werner a dit (le 13 mars 2003 à 17h45)
    Citation:
    Excuse moi Rog je pense que c'est toi qui fait la course a la poste...
    Depuis quand on peut faire ses courses à la poste ? Bonjour Mr la poste je voudrai une boîte de sardines
  116. highlander a dit (le 13 mars 2003 à 17h49)
    mdr
  117. rog62 a dit (le 13 mars 2003 à 18h41)
    Citation:
    Provient du message de chalouf
    Excuse moi Rog je pense que c'est toi qui fait la course a la poste tu as posté 40 messages en memes pas une nuit.
    Alors avant de dire n'importe quoi refléchis un peu.

    Mes amities!
    Tu te gardes tes amitiés et tu apprends à lire qui écrit les posts qui te sont adressés... :angry:
  118. Skipp a dit (le 13 mars 2003 à 18h44)
    Oulah y'a du rififi
  119. highlander a dit (le 13 mars 2003 à 18h52)
    Non mais vous avez quel âge pour jouer a celui qui post le vite, là !! :mad:
    Et puis on est sur un post qui parle de Génome@Home donc je ne voit pas le rapport; vous êtes hors-sujet les gars !! :angry:
  120. rog62 a dit (le 13 mars 2003 à 19h00)
    Citation:
    Provient du message de highlander
    Non mais vous avez quel âge pour jouer a celui qui post le vite, là !! :mad:
    Et puis on est sur un post qui parle de Génome@Home donc je ne voit pas le rapport; vous êtes hors-sujet les gars !! :angry:
    Si Chalouf a des griefs à formuler à quelqu'un... qu'il les adresse à la bonne personne
  121. Werner a dit (le 13 mars 2003 à 19h17)
    Bon revenons à nos moutons J'ai une petite question pour ceux qui génomisent à fond

    Est-ce qu'il y a un moyen de règler le filtrage des unitées pour tout le temps bosser sur un gros gène ?
  122. highlander a dit (le 13 mars 2003 à 19h24)
    Utilise Folding@Home il fait aussi du Genome@Home
    Il fait des plus gros calcule voir ici
    Il suffit de le configurer pour qu'il fasse du G@H !!
  123. Werner a dit (le 13 mars 2003 à 19h40)
    Eh bien j'ai testé à plusieurs reprises et j'ai parcouru les forums, dont celui que tu donnes, mais apparemment sur trois calculs avec le F@H aucun n'a été comptabilisé... sinon toi tu tournes avec le client F@H ?
  124. highlander a dit (le 13 mars 2003 à 19h48)
    Citation:
    Provient du message de Formatman
    Eh bien j'ai testé à plusieurs reprises et j'ai parcouru les forums dont celui que tu donnes, mais apparement sur trois calcul avec le F@H aucuns n'a été comptabilisé... sinon toi tu tourne avec le client F@H ?
    Cela prends un certain temps cela dépends de ta ou tes bécane(s)
    En ce qui me concerne je l'ai essayé mais étant donné que cela prend plus de temps à calculer un gène (j'ai un P3 800) j'ai abandonné , mais j'utilise toujours le G@H
    Comme tu le disait précédemment je crois qu'il n'y a pas moyen de règler le filtrage des unitées pour tout le temps bosser sur un gros gène. C'est lui qui choisi à ce que j'ai compris !!
    Ca ce serait bien mais ce n'est pas le cas dommage !!
  125. Werner a dit (le 13 mars 2003 à 19h52)
    Je le retesterai un coup ce soir pour voir (ce sera mon 4ème tests ).
  126. highlander a dit (le 13 mars 2003 à 19h54)
    Citation:
    Provient du message de Formatman
    Je le retesterai un coup ce soir pour voir (ce sera mon 4ème tests ).
    Tu me dira combien de temps tu as mis a faire un calcul avec si tu y arrive bien sur !!
  127. Werner a dit (le 13 mars 2003 à 19h57)
    OK pas de problème, mais je peux te dire qu'avec un PIV 2.26 c'était très long (facile 12 heures).
  128. highlander a dit (le 13 mars 2003 à 20h03)
    Citation:
    Provient du message de Formatman
    OK pas de problème, mais je peux te dire qu'avec un PIV 2.26 c'était très long (facile 12 heures).
    Ah oui en effet donc avec mon P3 800, ça doit mettre plus du double je pense !! (snif) Sinon j'ai un PIV 2.40 Ghz mais il ne calcul pas tous le temps
  129. chalouf a dit (le 13 mars 2003 à 20h08)
    Excuse moi Rog je parlais de Enzo 19 et c'est lui qui a commencé a en parlé.
  130. Werner a dit (le 13 mars 2003 à 20h13)
    Ce n'est pas très grave qu'il ne calcule pas tout le temps l'important c'est de participer Les PIII 450 que j'ai mis en place sont utilisés alors des fois ils y en a qui produisent seulement un envoi en 7 jours Le gros du travail est fait surtout avec un serveur (bloqué sur un des CPU qui tourne à 1.26 GHz) et deux stations (PIV à 2.26 et 3.06GHz).

    Dommage qu'il n'y est pas plus de membres du forum car même si le génome n'est pas utilisé 24/24 ça peu nous aider
  131. enzo19 a dit (le 13 mars 2003 à 20h15)
    lol stop... génomise Chalouf c tout, je te demandais de faire plus attention à tes posts Chalouf, c tout prend pas la mouche au vol comme un rien... prend de la tisane mon ami

    Formatman, je comprends pas ton problème : pourquoi et que veux-tu filtrer en fait ?
  132. highlander a dit (le 13 mars 2003 à 20h19)
    Il faudrait mettre de la pub sur le portail pour embauché plus de monde genre un bandeau. Ne me demande pas à moi je ne suis pas un as du graphisme (vu la tête du mien dans ma signature)
  133. Werner a dit (le 13 mars 2003 à 20h22)
    Enzo avec le client G@H le filtrage du calcul monte maxi à 100 alors que sur le F@H c'est bien plus. Comme c'est ça qui détermine le score à la fin du calcule je voulais pouvoir passer la barrière des 100 voili voilou
  134. highlander a dit (le 13 mars 2003 à 20h29)
    Ah ok c'était pour rattrapper Enzo fallait le dire tous de suite
    Enzo attend-nous on arrive
  135. Werner a dit (le 13 mars 2003 à 20h31)
    LOL je crois qu'on est pas près de le rattraper notre Enzo international
  136. Cougar a dit (le 13 mars 2003 à 20h32)
    ouais ben bon, que tu fasses un calcul à 500 WU ou 50 calcul à 10 WU ça revient au même tu mettras le même temps je pense, non ?
  137. chalouf a dit (le 13 mars 2003 à 20h34)
    Merci Enzo j'aime tes phrases.
  138. highlander a dit (le 13 mars 2003 à 20h34)
    Citation:
    Provient du message de Cougar
    ouais ben bon, que tu fasses un calcul à 500 WU ou 50 calcul à 10 WU ça revient au même tu mettras le même temps je pense, non ?
    Hmm je crois bien que t'ai raison !! je le crains
  139. Werner a dit (le 13 mars 2003 à 20h36)
    Peut-être pas 500 mais au moins 150 sinon je vais y passer une bonne partie de mon existance Pour le temps remarque je ne sais pas si ça joue réellement car au taf y a une machine en nonet qui calcul tjrs avec le même nombre au niveau du filtrage et il y a des jours où elle va m'en pondre bcp plus que d'habitude... c'est ptet un bug ou un cas isolé
  140. highlander a dit (le 13 mars 2003 à 20h43)
    ben ça je ne peut pas te répondre désolé il faut voir sur les forums spécialisé !!
  141. enzo19 a dit (le 13 mars 2003 à 20h44)
    Je pense aussi !
    Maintenant, pour me rattraper, vous y arriverez car je stagne souvent car c'est pas facile de monter une fois bien classé (tout le monde mouline à fond), quant à dépasser mon équipe avec le monde que vous recrutez, se sera très facile car on est pas beaucoup dans l'équipe... et vous vous progressez méchamment
  142. chalouf a dit (le 13 mars 2003 à 20h52)
    Moi je suis disponible!
  143. Skipp a dit (le 13 mars 2003 à 23h47)
    Perso je genomise déjà dans une autre team et sous un autre pseudo
  144. chalouf a dit (le 13 mars 2003 à 23h52)
    Ah bon lequel ?

    Skippy!
  145. Skipp a dit (le 13 mars 2003 à 23h57)
    Mouarf

    Voilà c'est ici chaloupe
  146. chalouf a dit (le 14 mars 2003 à 00h01)
    Merci de la loupe!
  147. enzo19 a dit (le 14 mars 2003 à 08h04)
    Sir HastuR !
    Chalouf, être dispo c'est bien, agir c'est mieux
    Suis les instructions au début du sujet et commence à genomiser !
  148. chalouf a dit (le 14 mars 2003 à 09h11)
    Je suis et j'ai éte dispo
  149. streets a dit (le 14 mars 2003 à 15h40)
    Citation:
    Provient du message de highlander
    Utilise Folding@Home il fait aussi du Genome@Home
    Il fait des plus gros calcule voir ici
    Il suffit de le configurer pour qu'il fasse du G@H !!
    Hi Highlander ,

    je vien de voir que les derniere version de rage 3DTweak integrent f@h.Cela m'ineteresse car le 2eme pc ou je voualait installer g@h est equipé d'une radeon et d'un Athlon 1600+

    Sinon tous ce que je vois apparenté a f@h c un fichier client.cfg

    Citation:
    [settings]
    username=Rage3D Tweak User
    team=64
    asknet=no
    userid=

    [http]
    active=no
    host=localhost
    port=8080
    usereg=yes
    que dois-je modifier pour qu'il fasse du g@h pour ndfr?
    est-ce possible d'utiliser g@h et f@h sur un meme pc vu que je vais installer rage 3D tweak sur mon PC?

    +
  150. highlander a dit (le 14 mars 2003 à 16h20)
    • Déjà tu supprime "client.cfg".
    • Tu lance FAH3Console.exe
    • Ensuite il te demande de le configurer, donc tu mets ça :
    Code:
    User name [highlander_NDFR]?
    Team Number[0]? 704901201
    Ask before fetching/sending work [no] (yes/no)?
    Use Internet Explorer Settings [no] (yes/no)?
    Use proxy [no] (yes/no)?
    Change advanced options [no] (yes/no)? yes
    Core Type [no-pref] (no-pref/fah/gah)? gah
    Core Priority [idle] (idle/low)?
    CPU usage requested (5-100)?
    Disable highly optimized assembly code [no] (no/yes)?
    Ignore deadline information (mainly useful if
     system clock frequently has errors)? [no] (no/yes)?
    Machine ID (1-4) [1]?
    • Tu remplace mon User Name par le tien.
    • Le numéro tu mets celui qui est indiqué (sinon tu ne sera pas vu dans les stats )
    • Pour le le "Core Type" tu mets "gah" si tu veux faire que du G@H ou "fah" pour du F@H, si tu veux faire des 2 tu mets "no-pref".
    • Pour "Machine ID" cela correspond au numéro de ta machine (mais je ne sais pas si cela change grand chose si tu mets rien (Défaut=1))
  151. streets a dit (le 14 mars 2003 à 16h51)
    Pas de FAH3Console.exe sur c: .Le programme doit etre integré ds rage3D tweak - pas folle la geppe.On dit faire absolument du f@h rour rage3D apparament ?
    il y a juste un repertoire folding et le fichier *.*cfg dedans.
    je pensais qu'en modifiant le fichier cfg ca irrait
    Merci de ces precison qd meme Highlander
  152. highlander a dit (le 14 mars 2003 à 16h58)
    ah donc ATI obligerai les possesseurs de ce type de carte a faire du F@H (Et bien heureusement que je n'en ai pas )

    Citation:
    Merci de ces precison qd meme Hilander
    Je suis là pour ça !!

    ps: c'est Highlander :angry:
  153. Mala a dit (le 14 mars 2003 à 21h36)
    Moi je ne tourne que sous le client F@h. et c'est vrai que vous pourrez constater sur mes stats que le nombre de gènes calculés est très faible en regard de mon score !!!

    Qqn peut m'expliquer ?
  154. highlander a dit (le 14 mars 2003 à 21h41)
    J'ai vu ça (dis donc tu m'as dépassé, c'est pas bien :angry: )

    Pour ce qui est de ta question, j'ai vu ça dans un de ces forums ici ou mais je ne sait plus où. Alors il faut que tu recherche (amuse toi bien )
  155. Werner a dit (le 14 mars 2003 à 21h48)
    Comme les devs ont vus que c'était plus long à calculer et que la méthode de calcule du client n'est plus du tout la même, ils ont décidés d'attribuer plus de points par gène à ceux qui utilisent le client F@H pour le G@H.
  156. enzo19 a dit (le 14 mars 2003 à 22h02)
    Citation:
    Provient du message de chalouf
    Je suis et j'ai éte dispo
    Alors genomise et rejoint la team !
  157. chalouf a dit (le 14 mars 2003 à 22h04)
    J'ai installé le programme, mais je ne sais pas où il s'est mis !
    Vous avez oublié de me mettre dans la team !!
  158. Cougar a dit (le 14 mars 2003 à 22h45)
    C:\Program Files\Genome@home
  159. chalouf a dit (le 14 mars 2003 à 23h54)
    Non justement quand je veut l'installer sa bloque et le programme se ferme!
    Enzo ma dit de rebooter mais j'ai la flemme là!!
    Mais je n'ai pas bien compris l'utilité du programme...
  160. Werner a dit (le 15 mars 2003 à 00h01)
    C'est expliqué dans le sujet
  161. Cougar a dit (le 15 mars 2003 à 00h05)
    jte redonne le liens pour télécharger une version déjà "installée"
    http://perso.wanadoo.fr/ndfr/Genome@home.ace

    j'ai eu le même prob que toi (d'après ta description)
  162. rog62 a dit (le 15 mars 2003 à 00h12)
    Citation:
    Provient du message de Cougar
    jte redonne le liens pour télécharger une version déjà "installée"
    http://perso.wanadoo.fr/ndfr/Genome@home.ace

    j'ai eu le même prob que toi (d'après ta description)
    Le lien est mort (décidément, j'ai pas de chance aujourd'hui)
  163. Cougar a dit (le 15 mars 2003 à 00h17)
  164. chalouf a dit (le 15 mars 2003 à 01h17)
    Oui mais ya un tas de truc que je ne comprend , meme en lisant le sujet on ne comprend pas tout..
  165. Werner a dit (le 15 mars 2003 à 01h21)
    bah y a rien à comprendre il faut juste savoir lire, écrire la première fois que tu lances le client... ensuite double cliquer pour ouvrir le client ou cliquer sur la croix pour le fermer...

    Qu'est ce que tu veux savoir Auguste ?
  166. highlander a dit (le 15 mars 2003 à 01h38)
    Vous avez vu les gars, nous 188ieme. Allez un piti effort, il faut que l'on arrive au moins à la barre des 100 et même plus haut !! Stats
  167. Werner a dit (le 15 mars 2003 à 01h51)
    J'ai engagé Alex pour nous aider (3060 MHz en +)
  168. Alexlesioux a dit (le 15 mars 2003 à 01h56)
    C'est avec honneur que j'accepte j'en suis à la séquence 7 60% et aprés roulez jeunesse
  169. highlander a dit (le 15 mars 2003 à 01h57)
    Cela fait combien en tous (de Mhz oups de Ghz ) !!
  170. Werner a dit (le 15 mars 2003 à 01h58)
    Presque 50 GHz le premier message est MAJ au fait
  171. highlander a dit (le 15 mars 2003 à 02h02)
    50 c'est la moitié de 100 donc vous savez ce qu'il vous reste à faire (en tous cas ceux qui ne sont pas inscrit)

    Allez au boulot, On Génomise, Hop, Hop, Hop
  172. Mala a dit (le 15 mars 2003 à 02h20)
    Normalement d'ici Le WE prochain je rajoute un celeron 667. c'est po grand chose mais bon c'est toujours ca !
  173. streets a dit (le 15 mars 2003 à 03h04)
    Citation:
    Provient du message de highlander
    ah donc ATI obligerai les possesseurs de ce type de carte a faire du F@H (Et bien heureusement que je n'en ai pas )

    Je suis là pour ça !!
    ok! mais c po ati qui oblige a faire du f@h c rage3D mais on peut le decocher lors de l'install du tweak
    dommage si je peux po le configurer :confused:


    PS: c corrigé
  174. enzo19 a dit (le 15 mars 2003 à 05h40)
    Citation:
    Provient du message de Mala
    Normalement d'ici Le WE prochain je rajoute un celeron 667. c'est po grand chose mais bon c'est toujours ca !
    Exactement c'est toujours ça
    Genome tourne sur presque toutes les machines, donc pas d'hésitation, si vous avez un 486 DX2 66 il ne faut pas l'oublier
    (sur un 8088, ca risque cependant d'être un peu chaud )
  175. highlander a dit (le 15 mars 2003 à 15h44)
    Citation:
    Provient du message de enzo19
    Exactement c'est toujours ça
    Genome tourne sur presque toutes les machines, donc pas d'hésitation, si vous avez un 486 DX2 66 il ne faut pas l'oublier
    (sur un 8088, ca risque cependant d'être un peu chaud )
    J'avais un 486 SX 25 Mhz (enfin il est débranché et à la cave ), mais a ton avis combien de temps devrais mettre un gène ? une semaine, 15 jours, 1 mois ou plus ?
  176. rog62 a dit (le 15 mars 2003 à 15h55)
    Citation:
    Provient du message de highlander
    J'avais un 486 SX 25 Mhz (enfin il est débranché et à la cave ), mais a ton avis combien de temps devrais mettre un gène ? une semaine, 15 jours, 1 mois ou plus ?
    Heu...... Un certain temps..... J'ai gagné?.....
  177. matt-fly a dit (le 15 mars 2003 à 17h06)
    bon ben si on peut faire tourner les petites config, j'ai deux 286 (poussiereux) pret a tout peter amstrad (je sais plus quoi) ca peut aussi ?
  178. highlander a dit (le 15 mars 2003 à 17h11)
    Citation:
    Provient du message de Blax`
    bon ben si on peut faire tourner les petites config, j'ai deux 286 (poussiereux) pret a tout peter amstrad (je sais plus quoi) ca peut aussi ?
    Whaou!! je c'est pas si ça va tourner sur Amstrad, en tous cas si ça tourne ça va mettre a peu près un siècle pour faire un gène !!
  179. Cougar a dit (le 15 mars 2003 à 17h13)
    Citation:
    Provient du message de Blax`
    bon ben si on peut faire tourner les petites config, j'ai deux 286 (poussiereux) pret a tout peter amstrad (je sais plus quoi) ca peut aussi ?
    ça fera un rapport electricité consomé/unité calculé assez important

    à long terme ça coutera moins cher d'acheter une config neuve ^^
  180. matt-fly a dit (le 15 mars 2003 à 17h26)
    t'as pas tord Coug, j'avais pas pense a ca donc ils vont rester pleins de poussiere encore quelques annees
  181. enzo19 a dit (le 16 mars 2003 à 09h13)
    C'est dommage que ces trouyous prennent la poussière : C'est des pièces de musée !
  182. streets a dit (le 16 mars 2003 à 15h20)
    bon je vais lancer G@H sur mon Atari 1024STE si il existe encore
  183. highlander a dit (le 16 mars 2003 à 15h25)
    Pendant que l'on y est, est-ce que ça tourne sur PalmOS ou sur PocketPC ou autre Agenda électronique aussi ?!?
  184. streets a dit (le 16 mars 2003 à 15h49)
    Sous windows CE ce serait p-e possib :chinese:
  185. streets a dit (le 19 mars 2003 à 17h52)
    C bon Formatman,
    Tu peut rajouter un Athlon 1600+@ ~1.4Ghz
    ce qui frais 800Mhz+1,4Ghz= 2,2Ghz pour moi
  186. Werner a dit (le 19 mars 2003 à 19h00)
    Voili voilou c'est mis à jour
  187. highlander a dit (le 19 mars 2003 à 19h11)
    Mais c'est génial ça !!
    Je suis sur qu'à la fin du mois prochain nous sommes dans le Top 100 (vu le nombre de Teams Inactive )
    Allez !! on va tous les écraser, ils ne vont même pas s'en apercevoir !!

    Il y en a un qui a abandonné son équipe
    Bravo enzo19 pour avoir fait ce type d'action
    Tu as combien de Go
    Bienvenue chez nous !!
    Il faudrait qu'il y est d'autres personnes qui fassent ce genre d'action plus souvent
  188. enzo19 a dit (le 19 mars 2003 à 20h09)
    lol, j'ai pas abondonné mon équipe, je ne lâche pas comme ça. Je tiens juste à contribuer à la montée de NDFR

    Donc j'ai mis un Celeron 1.7 GHz et si je trouve le temps, j'en ferais tourner une dizaine plus un bi-pro... mais pour l'instant pourrais pas, très honnêtement
  189. Junta_ a dit (le 19 mars 2003 à 20h42)
    format dans qque jour tu pourra remplacer un 1.2Ghz par un 2.2Ghz
    (normalement ce WE)
  190. jhack a dit (le 19 mars 2003 à 22h33)
    bonjour je tourne avec un 2.1ghz pour le genome depuis le 17 mars avant je tournais pour SETI mais cela n'apporte rien a mes semblables alors je prefere aider la medecine.
    mon pseudo est jhack et je voudrais savoir si je suis bien inscrit dans votre groupe de travail...
    merci
    jhackp@wanadoo.fr
    je travaille sous dos car j'ai pas reussi a demarrer un sequence sous windows
  191. Werner a dit (le 19 mars 2003 à 22h40)
    Salut et bienvenue !

    Pour l'instant je te vois en 19155 ème place du classement des utilisateurs. La fiche de l'équipe n'est peut-être pas à jour ou il y a un soucis au niveau du numéro de l'équipe qui est 704901201 pour Newdimension-Fr.
  192. Cougar a dit (le 19 mars 2003 à 22h40)
    on verra si tu es avec nous après ton premier envoie ( 30 séquences d'effectuées)
  193. Werner a dit (le 19 mars 2003 à 22h41)
    Le problème c'est qu'il est déjà dans le classement individuel. Ton dernier envoi remonte à quand ?
  194. enzo19 a dit (le 20 mars 2003 à 08h16)
    Aujourd'hui, j'ajouterai certainement des UC supplémentaires pour NDFR...
  195. Cougar a dit (le 20 mars 2003 à 08h36)
    Houla la Neoteam s'accroche à nous, faut lui mettre au moins 2-3 places dans la vue

    pédalez plus vite !
  196. jhack a dit (le 20 mars 2003 à 10h15)
    mon dernier envoie remonte a ce matin 8h00
    sinon comment faire pour entrer le numero team ?
    a part supprimer tout le prog et rerentrer le numero au lancement ?!
    jhackp@wanadoo.fr

    (attend reponse sur cette adresse merci)
  197. jhack a dit (le 20 mars 2003 à 10h18)
    suite ...

    en fait tout en haut de ma page DOS j'ai une ID Client !
    516877729319071927
  198. jhack a dit (le 20 mars 2003 à 10h22)
    suite encore ...

    faut il rentrer NDFR ou Newdimension-Fr
    ou cela et il inutile comme nom de genome team et on peut rentrer ce que l'on veut ?
    ou alors si seulement l'ID client est necessaire ?
    ... a bientot pour d'autres questions...
    apres on fait un manuel !
  199. Werner a dit (le 20 mars 2003 à 11h15)
    Salut tu dois toujours mettre le numéro de la team qui est 704901201 si tu as le client Genome@Home tu ne devrais pas avoir de problème. Par contre, si tu as téléchargé le client Folding@Home il faut non seulement préciser le numéro d'équipe, mais aussi dire que tu veux faire du Genome@Home en changeant les options avancées.

    Petit écran de configuration de Folding@Home ici

    Comme on peut le voir je mets "Core Type ? gah"

    Vérifie dans ton fichier "client.cfg" que tu as le bon numéro d'équipe
  200. streets a dit (le 20 mars 2003 à 13h30)
    format->est ce qu'en modifiant le cfg on peut faire du f@h pour ndfr?
    ou fo passer absolument par la console ?
  201. Werner a dit (le 20 mars 2003 à 13h49)
    Nous ne somme pas inscrit dans les équipe de F@H donc ton calcule sera donné à n'importe quelle équipe... c'est pour ça qu'il faut préciser gah dans les options avancées.
  202. jhack a dit (le 20 mars 2003 à 20h08)
    je m'etais trompé dans le numéro d'identification
    mais j'ai GENOME@HOME
    et il ne me demande jamais le core type ?!
  203. Skipp a dit (le 20 mars 2003 à 20h32)
    Comme tu utilises la version ligne de commande c'est normal
  204. Spycam a dit (le 21 mars 2003 à 19h36)
    La team NewdimensionFR est 165° : au boulot !!! :banana:
    Pour ma part je vais lancer une vaste campagne ( ) de pub pour notre team. Espérons que des nobles gens adhèrerons à notre cause... :rambo:
  205. highlander a dit (le 21 mars 2003 à 19h51)
    Et nous sommes 20° en nombre de WU par jour
  206. streets a dit (le 22 mars 2003 à 12h52)
    Fo faire grimper ca vite fait
  207. Junta_ a dit (le 23 mars 2003 à 01h09)
    Citation:
    Provient du message de Junta_
    format dans qque jour tu pourra remplacer un 1.2Ghz par un 2.2Ghz
    (normalement ce WE)
    voila voila monsieur formatman, mon 2.2Ghz est monté et il génomise
    donc tu peux enlever mon ancien 1.2Ghz pour le remplacer par mon nouveau 2.2Ghz
  208. Werner a dit (le 24 mars 2003 à 15h27)
    C'est modifié sinon ce serait bien de vous mettre en -nonet car le serveur semble déconner à gogo depuis samedi... peut-être que vos génome ne seront pas comptabilisés.
  209. LeFreeman a dit (le 24 mars 2003 à 17h22)
    Bon je vais me mettre à Genomiser, moi aussi pour NewdimensionFR (704901201)
  210. Werner a dit (le 24 mars 2003 à 18h11)
    Bienvenue LeFreeman

    Eh bien c'est génial toutes les équipes et les utilisateurs ont regressés dans les statistiques du serveur Genome à croire qu'ils ont remis une ancienne sauvegarde qui date de matusalem. D'après ma fiche, mon dernier envoi date du 13 mars 2003 J'ai donc récupéré tous mes envois depuis début mars sur ma clé USB

    PS: si vous faites des envois gardez vos genome dans un coins...
  211. highlander a dit (le 24 mars 2003 à 18h40)
    Comment ce fait-il que l'on ai régressé autant 196° au-lieu de 163 . C'est inadmissible, c'est une honte :angry: . Il fait remonter et plus vite que ça !!
  212. streets a dit (le 24 mars 2003 à 20h46)
    fo po baisser les bras allors qu'on commence a decoler
    si je peux ce week-end je met 1 autre pc au boulot
  213. Werner a dit (le 25 mars 2003 à 09h25)
    LOL les statistiques semble fonctionner à nouveau http://www.setiatwork.com/cgi-bin/ga...am=&stat=teams

    En même temps bon anniversaire Highlander
  214. enzo19 a dit (le 25 mars 2003 à 10h54)
    Oui je confirme que ca ne monte pas bien vite là. Au taf les zomes.... faut pas relâcher la pression !!!!

    700 pions par jour minimum c tout !
  215. highlander a dit (le 25 mars 2003 à 12h19)
    Citation:
    Provient du message de Formatman
    En même temps bon anniversaire Highlander
    Je te remercie Format
  216. rog62 a dit (le 25 mars 2003 à 12h40)
    Citation:
    Provient du message de highlander
    Je te remercie Format
    25 X Happy Birthday...
  217. streets a dit (le 25 mars 2003 à 21h01)
    Joyeux annivaisaire highlander

    Ajout d'un P4 1,8 Ghz pour moi enfin pour nous


    PS:merci a Sauron
  218. Alexlesioux a dit (le 25 mars 2003 à 21h19)
    Je vois que les chiffres ont été remis à jour car hier quand j'ai regardé je n'étais même plus dans la liste mais maintenant tout est revenu dans l'ordre

    PS : Bon anniversaire highlander :birthday:
  219. Werner a dit (le 25 mars 2003 à 22h50)
    Streets : Sauron tournera avec ton pseudo ?
  220. streets a dit (le 25 mars 2003 à 23h10)
    oui je l'ai mis sous mon peusdo




    que la force de son pc soit avec lui
  221. highlander a dit (le 26 mars 2003 à 01h46)
    Citation:
    Provient du message de rog62, streets, Alexlesioux
    Joyeux annivaisaire highlander
    Merci à vous les gars

    Eh! nous sommes 156°!! Allez Go! Go! Go! En route pour la 1° place
    Nous allons battre ces satané "P2P_Projet100k". Ne me dites pas que c'est impossible, je vous dis que si. Nous ne sommes pas arrivée jusque là pour lacher, alors on continue
  222. nonoghost a dit (le 26 mars 2003 à 09h48)
    vous etes un bande de malades
    Quand je vois les scores et le moyennes des autres equipes, genre "Les_decodeurs_Fous", je me demande ce qu'ils ont a dispos pour le Genome@home, d'ailleurs Formatman, peux tu nous rappeler la puissance totale de NDFR ? histoire qu'on rigole ???
  223. highlander a dit (le 26 mars 2003 à 15h37)
    Puissance totale NDFR: 56 051 Mhz
    Et on ne rigole pas :angry:
    Et le premier, où je vois rien que je début d'un sourir je le décapite, OK !!
    Il ne faut pas plaisanter avec ces choses là !
  224. Werner a dit (le 26 mars 2003 à 16h35)
    Les décodeurs fous sont présent depuis très longtemps et nous ne sommes pas nombreux dans l'équipe alors qu'au nombre d'unités envoyées par jour et la moyenne, nous sommes plutôt bien classé (http://www.setiatwork.com/cgi-bin/ga...am=&stat=teams). Les décodeurs sont 42 dans leur équipe... le projet100k ils sont bien plus de 200 il me semble... donc on est pas si mal et puis dans peu de temps nous aurons de nouvelles machines si tout va bien (elle sorte le 17 Avril et c'est des Bi-PIV 3.06GHz ).
  225. Spycam a dit (le 26 mars 2003 à 16h47)
    Comment attirer du monde dans notre team ?
    Y aurait pas moyen de faire de la pub sur la page d'accueil du site ? :rolleyes:
  226. streets a dit (le 28 mars 2003 à 00h38)
    Citation:
    Provient du message de Formatman
    Bienvenue LeFreeman

    Eh bien c'est génial toutes les équipes et les utilisateurs ont regressés dans les statistiques du serveur Genome à croire qu'ils ont remis une ancienne sauvegarde qui date de matusalem. D'après ma fiche, mon dernier envoi date du 13 mars 2003 J'ai donc récupéré tous mes envois depuis début mars sur ma clé USB

    PS: si vous faites des envois gardez vos genome dans un coins...

    Oui et comment fait-on pour sauvegarder ses genomes?

    Sinon ajout d'un nouveau sous mon pseudo d'un athlon 1700+
    merci a Kaldenine au passage

    athlon 1700+@~1.5Ghz
    athlon 1600+@~1.4Ghz
    P4 1,8 Ghz @ 1,8GHz
    PIII 800Mhz
    --------------------------------
    Ce qui doit faire en gros 5,5Ghz pour resumer
  227. Cougar a dit (le 28 mars 2003 à 02h40)
    tu sauvegardes les fichiers qui commencent par output.qqchose
  228. Werner a dit (le 2 avril 2003 à 18h51)
    Hier nous avons battu notre record d'envois 2766.67 Units Allez on génomise !
  229. highlander a dit (le 2 avril 2003 à 18h57)
    Oh! mais c'est vrai ça !!
    Et nous sommes 142°
  230. streets a dit (le 2 avril 2003 à 22h05)
    P2P_Projet100k 18emes
    Alliance_francophone 8emes

    Sont les + actif

    aller continuer la resistance on est 140emes et c po fini
    21emes en nb de genes/j.
    La neOteam s'accroche derriere nous . . .
  231. Werner a dit (le 3 avril 2003 à 11h43)
    Vu sur Alliance Francophone

    Citation:
    Stanford vient d'indiquer sur son site officiel qu'à compter du 1° Mai 2003, le client 0.99 ne sera plus fonctionnel, plus aucune protéine calculée avec ce client ne sera validée dans les statistiques. Il faudra donc vous rabattre vers le tout nouveau client 3.24, qui est apparemment beaucoup plus utile à la science. Seule ombre au tableau pour le moment, l'impossibilité de faire tourner le client 3.24 sans connection Internet (mais Stanford y travaille).
    Je vais avoir quelques soucis s'ils ne règlent pas ce problème de -nonet
  232. chalouf a dit (le 3 avril 2003 à 12h40)
    pas mal du tout!!
  233. streets a dit (le 3 avril 2003 à 12h42)
    Le client 3,24 c du folding@home qu'on va faire alors
    sauf si je crois k'on peut preciser le client lol

    c serait l'occasion de remetre ta page a jour
    car dans Interface graphique GSpy. le lien marche plus par ex
    faudrait le remplacer par celui-ci
  234. nonoghost a dit (le 3 avril 2003 à 13h19)
    Mais dites moi, QQ utilise le folding@home ???
    Je le lance depuis 3 semaines et ls sats de l'equipe ou les stats perso ne sont jamais mise a jour, C normal ????

    http://folding.stanford.edu/cgi-bin/...ge?q=704901201

    Pourtant le client 0.99 tourne en meme temps et apparment celui la tient la route...

    QQ a le meme souci ???
  235. Werner a dit (le 3 avril 2003 à 13h30)
    Pour les paramètres du F@H je te redonne le lien de ma petite image

    http://formatland.beta.free.fr/f@h.png

    Je vais mettre à jour le lien merci Street
  236. Werner a dit (le 3 avril 2003 à 13h35)
    Désolé mais on parlait pas du même GSpy en fait donc je l'uploaderai plus tard car free à mit des quotas sur ces FTP (c'est nouveau ça ?)

    Citation:
    Connexion à ftpperso.free.fr sur le port 21. Tentative 1 de 3...
    220 ProFTPD 1.2.6 Server (ProFTPD: Serveur de mise a jour des pages sur perso.free.fr) [ftpperso2-1.free.fr]
    --------------------------------------------------------------------
    226 Quotas on: using 104802752.00 of 104857600.00 bytes
    Transfert de 418 octets en 0,01 secondes (27,21 Ko/s)
    STOR GSpy.rar
    150 Opening BINARY mode data connection for GSpy.rar
    550 Quota exceeded, GSpy.rar not stored
    Échec [raison inconnue]
  237. Mala a dit (le 3 avril 2003 à 13h53)
    Moi j'utilise F@h et aucun pb sur les stats.

    Par contre j'ai po tout pigé Formatman, est ce que ce changement de client concerne aussi le F@h ?
  238. streets a dit (le 3 avril 2003 à 15h07)
    Non les client de g@h devron passer par celui de f@h maintenant
    fo que je reinstall tout sur tout les pc now

    j'espere que la methode FireDaemon marchera toujours
  239. Werner a dit (le 3 avril 2003 à 15h32)
    Mala ne changes rien c'est parfait

    Streets FireDaemon devrait fonctionner de la même façon

    PS: lien modifié je ne devais pas être kler tout à l'heure...
  240. Mala a dit (le 3 avril 2003 à 21h48)
    Merci oh grand Manitou du Génome
  241. nonoghost a dit (le 3 avril 2003 à 23h18)
    Merci Format,

    je suis désolé pourtant ma config du folding@home (version 3.24 GUI) semble correcte, (édition du client.cfg) =>

    [settings]
    username=nonoghost
    team=704901201
    asknet=no
    machineid=1
    local=1

    [http]
    active=no
    host=localhost
    port=8080
    usereg=yes
    proxy_name=
    proxy_passwd=

    [graphics]
    drawgap=7500
    drawtitle=0
    drawlogos=0
    drawmode=1

    [core]
    priority=0
    cpuusage=95
    disableassembly=no
    ignoredeadlines=no

    [clienttype]
    type=2

    et pourtant les stats ne sont jamais mises a jour ?!?!

    Peux tu me donner l'URL des stats de ton équipe pour que je vois s'il faut que je me mette a boire ou pas ...

    Merci bcp,
  242. Cougar a dit (le 3 avril 2003 à 23h25)
    [settings]
    username=nonoghost
    team=704901201
    asknet=no
    machineid=1
    local=1

    si t'essayes de mettre yes
    Pasque je pense que c'est l'équivalent de la commande nonet.
  243. nonoghost a dit (le 3 avril 2003 à 23h35)
    nonhélas, C simplement pour demander s'il peut utiliser la connection ou pas ! Que ca m'énerve quand ca veut pas fonctionner Grrrrr !!

    encore un morceau du fichier de log ->

    --- Opening Log file [April 3 20:34:21]


    # Windows Graphical Edition ##########################################

    Folding@home Client Version 3.24

    http://foldingathome.stanford.edu
    email:help@foldingathome.stanford.edu

    ##########################################


    [20:34:21] - Ask before connecting: Yes
    [20:34:21] - Use IE connection settings: Yes
    [20:34:21] - User name: nonoghost (Team 704901201)
    [20:34:21] - User ID = 2E5B448070E2A7D5
    [20:34:21] - Machine ID: 1
    [20:34:21]
    [20:34:21] Loaded queue successfully.
    [20:34:21] Initialization complete
    [20:34:21] + Benchmarking ...
    [20:34:23]
    [20:34:23] + Processing work unit
    [20:34:23] Core required: FahCore_ca.exe
    [20:34:23] Core found.
    [20:34:23] Working on Unit 02 [April 3 20:34:23]
    [20:34:23] + Working ...
    [20:34:23] + Working...
    [20:34:24] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
    [20:34:24]
    [20:34:24] Proj: work/wudata_02
    [20:34:24] Finding work files
    [20:34:24]
    [20:34:24] Folding@Home2 Protein Design Core Shutdown: MISSING_WORK_FILES
    [20:34:28] CoreStatus = 74 (116)
    [20:34:28] The core could not find the work files specified. Removing from queue
    [20:34:28] Deleting current work unit & continuing...
    [20:34:32] + Attempting to get work packet
    [20:34:35] - Connecting to assignment server
    [20:34:36] - Successful: assigned to (171.64.122.125).
    [20:34:36] + News From Folding@Home: Welcome to Folding@Home
    [20:34:36] Loaded queue successfully.
    [20:34:37] - Deadline time not received.
    [20:34:39] + Connections closed: You may now disconnect
    [20:34:44]
    [20:34:44] + Processing work unit
    [20:34:44] Core required: FahCore_ca.exe
    [20:34:44] Core found.
    [20:34:44] Working on Unit 03 [April 3 20:34:44]
    [20:34:44] + Working ...
    [20:34:44] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
    [20:34:44]
    [20:34:44] Proj: work/wudata_03
    [20:34:44] Finding work files
    [20:34:44] sizeof(CORE_PACKET_HDR) = 512
    [20:34:44] Checking frame files
    [20:34:44] - Couldn't open work/wudata_03.chk
    [20:34:44] Starting from initial work packet
    [20:34:44]
    [20:34:44] Updating shared core-client information
    [20:34:44] - Writing "work/wudata_03.key": (overwrite)successful.
    [20:34:44] Key file to update shared file: work/wudata_03.key
    [20:34:44] keyfile: 0 113 200 15 2 1 0
    [20:34:44] Protein: LIF/pdblif1.33.xyz
    [20:34:44] - Frames Completed: 0, Remaining: 600
    [20:34:44] - Dynamic steps required: 120000
    [20:34:44]
    [20:34:46] Printed current.prm
    [20:34:46] Writing local files:
    [20:34:46] - Writing "work/wudata_03.key": (overwrite)successful.
    [20:34:46] - Writing "work/wudata_03.xyz": (overwrite)successful.
    [20:34:47] - Writing "work/wudata_03.prm": (overwrite)successful.
    [20:34:48] Starting design engine
    [20:34:48] [SPG] project name: work/wudata_03.
    [20:34:48] [SPG] 1 0
    [20:34:48] [SPG] Initializing protein design engine
    [20:34:48] [SPG] seed = 0
    [20:34:48] [SPG] Initialization complete
    [20:34:48] [SPG] Writing current.pdb, chainlength = 113
    [20:34:48] [SPG] Writing current.xyz
    [20:34:48] [SPG] Preprocessing . . .
    [20:34:48] [SPG] 113 positions in protein

    Que faire de plus ??? :angry:
    Fdisk + Format ???

    si QQ a une idée, ou veux + de renseignements, ou voit d'autres résultats que moi sur ce lien -> http://folding.stanford.edu/cgi-bin/...e?q=704901201, merci de m'en avertir :tired:

  244. streets a dit (le 3 avril 2003 à 23h45)
    compris fort et claire Formatman

    pour les stat de ndfr c'est ici ou bien ici aussi et il y'a plein d'autres pages stats si tu fouille un peut.
    Sinon tu est bien ds les stats :
    Dernier gène envoyé : jeudi 3 avril 2003, 13:59:50 CEST
    ou Last unit returned: Thu Apr 3 04:59:50 2003 (PDT)
  245. nonoghost a dit (le 3 avril 2003 à 23h53)
    D'accord Streets, mais uniquement pour le client G@H !!! pas pour le client F@H !!!
    C surtout ca qui m'inquiete, si je n'apparais pas sur le client F@H, je génomise peut etre pas pour rien mais certainement pas pour NDFR en tout cas...

    Les deux tournant en // , je génomise en attendant le 1er mai 2003...
  246. nonoghost a dit (le 4 avril 2003 à 01h10)
    Autre chose,

    Est ce que la Team NewdimensionFR existe aussi pour le client Folding@home 3.24 ??? he pis hein ??? d'abord !!!

    apparement non, car la recherche sur le site officiel renvoie sur la teams des "sans-team" (n°2 au classement général)

    Faut il que j'en crée une ???? car moi je ne me retrouve pas....
  247. Werner a dit (le 4 avril 2003 à 08h07)
    Normal que tu n'en trouve pas vu que l'on ne fait que du Genome même avec le client dédié au folding on lui dit que nous c'est le Genome qui nous intéresse
  248. nonoghost a dit (le 4 avril 2003 à 10h24)
    Citation:
    Provient du message de Formatman
    Normal que tu n'en trouve pas vu que l'on ne fait que du Genome même avec le client dédié au folding on lui dit que nous c'est le Genome qui nous intéresse
    Mais je sais bien tout ca !!!! Arretez de le repeter !!! :angry:
    moi aussi je lui ai dit que je voulais du genome@home dans son control panel -> onglet Advanced -> Client type -> Genome@home.

    tu crois pas que si c'étais aussi simple j'aurais trouvé ?!?!! :tired:

    Non, ce qui m'interesse vraiment c'est d'avoir l'URL de l'un d'entre vous quand vous faites le clic droit sur l'icone du F@H, placé dans le systray, ensuite STATUS et TEAM STATISTICS. :cheeky:

    Merci d'avance,
  249. nonoghost a dit (le 4 avril 2003 à 13h43)
    Je repose la question,
    Citation:
    Provient du message de nonoghost
    Autre chose,

    Est ce que la Team NewdimensionFR existe aussi pour le client Folding@home 3.24 ??? he pis hein ??? d'abord !!!

    apparement non, car la recherche sur le site officiel renvoie sur la teams des "sans-team" (n°2 au classement général)

    Faut il que j'en crée une ???? car moi je ne me retrouve pas....
    S'il faut le faire pour NDFR, je le fais!!! :birthday:
  250. Werner a dit (le 4 avril 2003 à 15h06)
    Bah je viens de le faire :

    New team NewdimensionFR with number 31922 has been founded by FORMATMAN

    Voilou donc ceux qui veulent faire du Folding@Home vous pouvez...
  251. highlander a dit (le 4 avril 2003 à 15h22)
    C'est dommage que l'on puisse pas utiliser les 2 N° en même temps (en alternant bien sur mais dans le même client), lorsque l'on utilise le client F@H en mode G@H/F@H
    Peut-être que si on a une bécane BI-CPU, c'est peut-être possible ?
    Moi j'en sais rien et ce n'est pas mon cas mais les autres aimeraientt peut-être savoir !
  252. nonoghost a dit (le 4 avril 2003 à 16h26)
    Non hélas, (bis)

    Pour le F@H comme le G@H, on ne le peut lancer qu'une seule fois. La deuxieme image, en voyant deja la premiere chargée en mémoire, s'arrete de suite.

    par contre on peut lancer le client G@H 0.99 et le F@H 3.24 ensemble... mais bonjour la conso de temps CPU (meme pour un bi-proc
  253. Werner a dit (le 4 avril 2003 à 16h46)
    Pour les Bi-CPU, Quadri-CPU il faut lancer autant de clients installés dans autant de répertoires qu'on a de processeur. C'est la même chose pour les mono CPU PIV HyperTreading j'en lance deux ce qui me fait environ 4 résultats par jour (soit + de 100 WU). Chaque client travaille dans son propre répertoire (c'est écrit dans la FAQ de Stanford).

    En gros ça donnera ça :

    - 1 Celeron = 1 client
    - 1 Duron = 1 client
    - 1 PIV = 1 client
    - 1 PIV HT = 2 clients
    - 1 Athlon XP = 1 client
    - 2 Athlon MP = 2 clients
    - 1 PIII = 1 client
    - 2 PIII = 2 clients
    - 2 PIV Xeon DP = 4 clients
    - 4 PIV Xeon MP = 8 clients
  254. highlander a dit (le 4 avril 2003 à 16h53)
    Et bien là je comprend mieux pourquoi tu va aussi vite
  255. nonoghost a dit (le 4 avril 2003 à 21h03)
    Bien cela fonctionne pour le G@H mais pas pour le F@H....
    Dommage...

    par contre ce que j'aime bien, c'est:

    Citation:
    1 Celeron = 1 client ....
    .... 1 PIV = 1 client
    C'est vrai qu'un PIV et un Celeron ont les memes perfs....

    Bon, d'accord je blague !!!! :lick:
  256. Werner a dit (le 4 avril 2003 à 22h10)
    Pour Folding@Home c'est le même principe il faut juste changer l'ID dans chaque répertoire ^^
  257. nonoghost a dit (le 4 avril 2003 à 23h20)
    oui, UNIQUEMENT avec le client en mode console mais pas celui avec la version GUI...

    C'est parti.... de + belle !!!!
  258. Werner a dit (le 4 avril 2003 à 23h59)
    Bah il faut utiliser le client en mode console alors ^^ je vais quand même tester car ça m'étonne.

    Raaaa ça ne marche pas c'est vraiment naze...
  259. highlander a dit (le 5 avril 2003 à 01h30)
    J'avais, au début que je Génomisais, essayé le GUI et même le screensaver et ça me faisait râmer à mort ma bécane.
    C'est sûr, c'est beau des gènes dont on comprend que dale et qui bouge dans tous les sens.
    Mais s'il faut que ça bloque tous, moi je préfère la bonne vieille console (pas si vieille que ça d'ailleurs ) même s'il n'y a pas d'animation, pourvue que cela fasse avancer la science (pas en mal j'espère, sinon j'arrête tous de suite)
  260. nonoghost a dit (le 5 avril 2003 à 11h09)
    Citation:
    Provient du message de Formatman
    Bah il faut utiliser le client en mode console alors ^^ je vais quand même tester car ça m'étonne.

    Raaaa ça ne marche pas c'est vraiment naze...
    Voui, c'est vrai...
  261. Werner a dit (le 11 avril 2003 à 00h19)
    Le premier message est mis à jour !

    Vivement une version du type -nonet Je viens de migrer quelques machines et c'est bcp plus long à calculer ce qui fait que les machines un peu anciennes vont être moins productives...
  262. stan a dit (le 16 avril 2003 à 00h12)
    Je me joins à l'équipe avec un p4 1,9Ghz pour le moment.
    Un p4 2,4Ghz va me rejoindre prochainement.

    Je me suis enregistré sous le pseudo stan38, mais je ne suis pas sûr que l'enregistrement ait passé... à confirmer
  263. streets a dit (le 16 avril 2003 à 00h26)
    bienvenu Stan, tu le saura je crois une foit un genome de crée
    c a dire apres les 30 sequances de calculées et le resutat envoyé.

    Sinon prochainement 2 PC vont po tourner pendant 3 semaines
    pour cause de vacances forcées
  264. matt-fly a dit (le 16 avril 2003 à 06h14)
    Suite à l'annonce hier à propos d Genome humain, j'ai arrêté 3 des 4 box. Je vais me renseigner si à ce stade, ça vaut encore le coup de faire tourner le soft
  265. Werner a dit (le 16 avril 2003 à 07h27)
    Bah en fait nous on décrypte pas le genome humain

    Citation:
    Le but de Genome@home est de dessiner de nouveaux gènes pouvant coder des protéines opérationnelles au sein de la cellule. Genome@home utilise un algorithme informatique (SPA), basé sur les règles physiques et biochimiques qui gouvernent les gènes et les protéines, afin de dessiner de nouvelles protéines (et à partir de là de nouveaux gènes), n'ayant pas été trouvés dans la nature. En comparant ces "génomes virtuels" à ceux trouvés dans la nature, nous sommes en mesure de bien mieux comprendre comment les génomes naturels ont évolué et comment fonctionnent les gènes et les protéines naturels. Parmi les applications importantes de la base de données de protéines virtuelles :

    - fabriquer de nouvelles protéines pour la médecine
    - concevoir de nouveaux médicaments
    - assigner une fonction aux douzaines de nouveaux gènes séquencés chaque jour
    - comprendre l'évolution des protéines
  266. enzo19 a dit (le 16 avril 2003 à 20h23)
    Donc on est pas près de s'arrêter !
    En fait, je me suis également posé la même question que Blax' alors que je vous ai lancé dans le projet
  267. chalouf a dit (le 17 avril 2003 à 01h49)
    Bon c'est cool tout sa mais moi je n'arrive toujours pas a l'installer!
  268. streets a dit (le 17 avril 2003 à 09h21)
    suffit de lancer l'exe et de rentrer les parametres pourtant
    L'alliance francophone grandit de jour en jour , ce srait bien d'avoir des nouveau membre chez nous aussi
  269. Werner a dit (le 17 avril 2003 à 10h02)
    On fera une news le 1er mai car en ce moment avec les deux clients et peut-être le nouveau que l'on attend avec impatience c'est un peu gallère à expliquer
  270. nonoghost a dit (le 17 avril 2003 à 11h13)
    Citation:
    Provient du message de Formatman
    On fera une news le 1er mai car en ce moment avec les deux clients et peut-être le nouveau que l'on attend avec impatience c'est un peu gallère à expliquer
    C lequel qu'on attend avec impatience ????

    Moi j'etais bien evec mon G@H... j'attends plus rien avec impatience. moke:
  271. Werner a dit (le 17 avril 2003 à 11h44)
    Un vrai client qui fusionne les deux projets et surtout avec un -nonet...
  272. chalouf a dit (le 17 avril 2003 à 12h20)
    Streets j'ai dejà expliqué mon problème !
  273. Spycam a dit (le 17 avril 2003 à 17h31)
    A koi correspond les membres inactifs dans les stats de gingko ?
    Je viens de m'apercevoir que j'y suis !!!!
    Pourtant je genome souvent !
  274. Werner a dit (le 17 avril 2003 à 17h58)
    Bizarre c'est peut-être parce que tu utilises le nouveau client enfin celui qui fait F@H et G@H ou c'est tout simplement un bug dans ses stats
  275. Spycam a dit (le 17 avril 2003 à 18h03)
    çà doit être un bug : j'utilise le client Genome 0.99
  276. Spycam a dit (le 19 avril 2003 à 14h33)
    Pour le tableau "Récapitulatif de la puissance de calcul" sur la première page, spycam100 c'est moi : j'ai un athlonXP 1500 +.
    Donc çà fait 1.33 Ghz de plus pour la team !
    :rambo:
  277. matt-fly a dit (le 19 avril 2003 à 16h14)
    je remettrai les box a genomiser dans quelques temps, le temps de finir differents travaillent, dans 2 semaines je pense
  278. Werner a dit (le 19 avril 2003 à 17h29)
    Merci pour cette précision Spycam

    Blax' -> OK pas de soucis
  279. stan a dit (le 19 avril 2003 à 19h47)
    formatman : tu pourras rajouter une nouvelle machine à mon crédit.

    Un P4 2.4Ghz qui vient s'ajouter à mon P4 1.9Ghz -> 4.3Ghz pour ma part
  280. Mala a dit (le 20 avril 2003 à 11h29)
    Et un celeron 667 pour moi il tournera seulement 2 ou 3 heures par jour mais bon tant qu'à l'allumer autant qu'il génomise nan ?
  281. Werner a dit (le 20 avril 2003 à 12h15)
    Merci les gars on avait bien besoin de ça vu le temps que ça met pour calculer avec le client 3.24
  282. bastien a dit (le 22 avril 2003 à 21h04)
    voila ! je suis de l'équipe !
  283. highlander a dit (le 22 avril 2003 à 22h56)
    A ce que je voit la famille s'agrandit
    Nouveau CPU, nouveau génomisateur et bientôt la barre des 100,du classement mondial va être atteint !!
    Et puis j'aimerai savoir pourquoi, il y a 11 membres inactifs !! :eek:
    Allez !! Je veux des explications et plus vite que ça !!
    Non!! Mais c'est quoi ce travail, on abandonne pas son poste comme ça !!
  284. Mala a dit (le 23 avril 2003 à 21h52)
    Moi si tout va bien dans 2 semaine je rajoute un p4 1.8 Ghz
  285. Werner a dit (le 28 avril 2003 à 08h27)
    J'ai passé le cap des 30 000 WU ce week-end et plus exactement 30 656 en 81 jours Dommage que Blax a arrêté, car il n'aurait pas tardé à atteindre cette barrière Bon aller les inactifs on se motive un peu

    N'oubliez pas de basculez vos client et d'envoyer vos derniers -nonet car la date fatidique arrive

    PS : on recrutera debut mai
  286. enzo19 a dit (le 28 avril 2003 à 16h57)
    Citation:
    Provient du message de Formatman
    J'ai passé le cap des 30 000 WU ce week-end et plus exactement 30 656 en 81 jours Dommage que Blax a arrêté, car il n'aurait pas tardé à atteindre cette barrière Bon aller les inactifs on se motive un peu

    N'oubliez pas de basculez vos client et d'envoyer vos derniers -nonet car la date fatidique arrive

    PS : on recrutera debut mai
    G a peut près 50 000 pions... j'aimerais tout mettre ici mais je vois pas comment faire... une ID formatman ?
  287. Werner a dit (le 28 avril 2003 à 17h28)
    Si tu veux basculer tous tes points il faut envoyer un mail à stanford. Je sais que Boulnoir des Décodeurs Fous à fais ça dernièrement car c'était écrit sur leur site.
  288. rog62 a dit (le 28 avril 2003 à 19h43)
    Citation:
    Provient du message de Formatman
    ...PS : on recrutera debut mai
    On verra si tu seras suffisamment convainquant…
  289. Werner a dit (le 28 avril 2003 à 19h52)
    au pire je sortirai l'artillerie lourde De toute façon elle va sortir, mais je ne sais pas trop ce que ça va donner sur du genome... Je ferai une news que quand nous aurons plus d'infos sur ce qu'il va se passer entre le 1 et le 5 mai (tout le monde devra être avec le client Folding d'ici là).
  290. rog62 a dit (le 28 avril 2003 à 20h03)
    Citation:
    Provient du message de Formatman
    au pire je sortirai l'artillerie lourde ...
    Lol...

    Citation:
    Provient du message de Formatman
    ... Je ferai une news que quand nous aurons plus d'infos sur ce qu'il va se passer entre le 1 et le 5 mai (tout le monde devra être avec le client Folding d'ici là).
    J'attends avec impatience cette news
  291. Werner a dit (le 29 avril 2003 à 17h47)
    Citation:
    Lol...
    je pense que 4 Xeon à 3.06GHz ça fera l'affaire

    Ils sont arrivé aujourd'hui et je dois les torturer 1 mois voir plus avant de les mettres en production donc c'est toujours bon à prendre pour nous 12 GHz à partir de demain promis ça genomisera
  292. Cougar a dit (le 29 avril 2003 à 18h29)
    tu en met qquns à mon nom ?
  293. Werner a dit (le 29 avril 2003 à 18h42)
    oui pourquoi pas, mais on avait dit que c'était un secret
  294. Cougar a dit (le 29 avril 2003 à 19h26)
    qu'est ce qui est secret ? ( fait semblant ils ont pas compris)
  295. highlander a dit (le 30 avril 2003 à 00h31)
    Citation:
    Provient du message de Cougar
    qu'est ce qui est secret ? ( fait semblant ils ont pas compris)

    Hein de quoi, qu'est-ce qu'on a pas compris ???
  296. Spycam a dit (le 30 avril 2003 à 13h19)
    Citation:
    Provient du message de highlander
    Hein de quoi, qu'est-ce qu'on a pas compris ???


    Plus qu'un jour avant la date fatidique...
    Patience, patience... leep:
  297. highlander a dit (le 3 mai 2003 à 05h00)
    Yes!! ça y est les gars on est dans le top 100
    Pourvu qu'on y reste !!
  298. Matt a dit (le 3 mai 2003 à 08h19)
    bah bien sûr qu'on va y rester ... et faut même qu'on continue à monter
  299. Cougar a dit (le 4 mai 2003 à 10h43)
    ouais ben j'ai installé la nouvelle version du client, je préfairai 1000 fois l'ancienne
    La version console je comprends pas ce qu'elle fait, elle download à chaque fois FAH_Core_XX.exe sans y parvenir, elle me fait les séquences n'importe comment, du genre elle change de protéine toutes les séquences, sympa...

    Donc jsuis passé à la version graphique, ça fait semblant de marcher, mais je sais pas si mes résultats vont être comptabilisé ^^

    Moralité : Pourquoi changer un soft qui marchait très bien
  300. nonoghost a dit (le 4 mai 2003 à 12h07)
    Attention Cougar, car personne ne genomise (a ma connaissance) sur la version graphique....

    J'avais demandé a Formatman de creer une equipe pour la version GUI mais apparement personne ne s'en sert... pas meme moi

    Moi je te conseille de rester a la version console... et on va voir si on peut la bricoler
  301. Werner a dit (le 4 mai 2003 à 12h35)
    C'est ton partage de connexion au net qui est foireux Coug Si ça peut te consoler j'avais aussi des messages d'erreur dans la version console hier après midi sur un serveur...
  302. Matt a dit (le 5 mai 2003 à 00h16)
    Format, tu peux ajouter 266 MHz pour mon compte
    (je sais, c'est petit ... mais c'est toujours ça ...)
  303. highlander a dit (le 5 mai 2003 à 14h50)
    Depuis un certain temps ça me mets ça et donc je ne peut pas génomiser !!
    Est-ce que ça fait ça à quelqu'un d'autre ? et qu'est-ce que je doit faire ?
    ps: Ca me fait au moins 5 fois de suite et après ça se met en sleeping !!

    Citation:
    [03:23:06] + Processing work unit
    [03:23:06] Core required: FahCore_ca.exe
    [03:23:06] Core found.
    [03:23:06] Working on Unit 01 [May 5 03:23:06]
    [03:23:06] + Working ...
    [03:23:06] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
    [03:23:06]
    [03:23:06] Proj: work/wudata_01
    [03:23:06] Finding work files
    [03:23:06] sizeof(CORE_PACKET_HDR) = 512
    [03:23:06] Checking frame files
    [03:23:07] Restarting from checkpointed files.
    [03:23:07]
    [03:23:07] Protein: SH3ligGH2/pdb1ckb.1.spa
    [03:23:07] - Frames Completed: 0, Remaining: 600
    [03:23:07] - Dynamic steps required: 120000
    [03:23:07]
    [03:23:08] Printed current.prm
    [03:23:08] Writing local files:
    [03:23:08] - Writing "work/wudata_01.key": (overwrite)successful.
    [03:23:08] - Writing "work/wudata_01.xyz": (overwrite)successful.
    [03:23:08] - Writing "work/wudata_01.prm": (overwrite)successful.
    [03:23:09] Starting design engine
    [03:23:09] [SPG] project name: work/wudata_01.
    [03:23:09] [SPG] 1 0
    [03:23:09] [SPG] Initializing protein design engine
    [03:23:09] [SPG] seed = 836539
    [03:23:09] [SPG] Initialization complete
    [03:23:09] [SPG] Writing current.pdb, chainlength = 65
    [03:23:09] [SPG] Writing current.xyz
    [03:23:09] [SPG] Preprocessing . . .
    [03:23:09] [SPG] 65 positions in protein
    [03:24:48] [SPG] Preprocessing complete
    [03:24:48] Iterations: 0 of 600
    [03:24:49] Finished
    [03:24:50] [SPG] Native chi angles stored
    [03:24:51] [SPG] Rotamers read
    [03:24:51] [SPG] Starting genetic algorithm
    [03:27:14] [SPG] seed: 836539
    [03:27:14] [SPG] Designing protein sequence 1 of 30
    [03:27:16] CoreStatus = 63 (99)
    [03:27:16] + Error starting core.
    [03:27:16] Folding@home will go to sleep for 1 day as there have been 5 consecutive Cores executed which failed to complete a work unit.
    [03:27:16] (To wake it up early, quit the application and restart it.)
    [03:27:16] If problems persist, please visit our website at http://folding.stanford.edu for help.
    [03:27:16] + Sleeping...
  304. Werner a dit (le 5 mai 2003 à 15h10)
    J'ai eu bcp de prob de ce genre ce week end et j'ai été obligé de vider les réperoires en laissant uniquement "FAH3Console.exe" et "client.cfg"... Le client est quand même moins stable depuis vendredi et je me tape des proteines de 136 voir même 152 ce qui prend un temps fou !
  305. Werner a dit (le 5 mai 2003 à 18h09)
    et j'ai oublié d'ajouter qu'aujourd'hui c'est la grosse catastrophe avec la plupart des clients :

    Citation:
    [07:52:14] + Attempting to send results
    [07:52:16] - Couldn't send HTTP request to server
    [07:52:16] + Could not connect to Work Server (results)
    [07:52:16] - Error: Could not transmit unit 02 (completed May 5). Keeping unit in queue.


    [07:52:16] + Attempting to send results
    [07:52:17] - Couldn't send HTTP request to server
    [07:52:17] + Could not connect to Work Server (results)
    [07:52:17] - Error: Could not transmit unit 02 (completed May 5). Keeping unit in queue.
    [07:52:17] + Attempting to get work packet
    [07:52:17] - Connecting to assignment server
    [07:52:32] + Could not connect to Assignment Server
    [07:52:33] - Couldn't send HTTP request to server
    [07:52:33] + Could not connect to Assignment Server 2
    [07:52:33] + Couldn't get work instructions.
    [07:52:33] - Error: Getwork #1 failed, and no other work to do. Waiting before retry
    [07:52:38] + Attempting to get work packet
    [07:52:38] - Connecting to assignment server
    [07:52:53] + Could not connect to Assignment Server
    [07:52:54] - Successful: assigned to (171.64.122.125).
    [07:52:54] + News From Folding@Home: Welcome to Folding@Home
    Impossible d'envoyer certains résultats ce qui fait que j'en ai une bonne dizaine en attente et j'espère que ça ne sera pas perdu
  306. Cougar a dit (le 5 mai 2003 à 18h10)
    je suis de faire une protéine de 180...3h par séquence lol, c'est interminable.
  307. highlander a dit (le 5 mai 2003 à 18h22)
    J'ai réinstallé F@H et ça à l'air de tourné
    C'est vrai que les protéine sont beaucoup plus longue a calculé
  308. Mala a dit (le 6 mai 2003 à 01h46)
    moi je suis en F@H depuis le début mais la il est souvent "Sleeping" depuis vendredi aussi !

    Bizarre !

    Pour le temps de calcul, c'est normal je crois il va faloir vous y habituer, moi c'est comme ca depuis le début
  309. Alexlesioux a dit (le 6 mai 2003 à 02h04)
    Mon calcul de génome ne marche plus je ne comprend plus rien je le lance normal et aprés deux trois seconde pouf plus rien il s'éteint comme une merde le programme se ferme tout seul si vous pouviez m'aidez votre aide est la bienvenue... :rolleyes:
  310. Werner a dit (le 6 mai 2003 à 08h26)
    Alex il faut changer de programme on en parle depuis quelques semaines déjà

    http://www.newdimension-fr.net/showt...=&pagenumber=1
  311. Spycam a dit (le 6 mai 2003 à 20h38)
    C'est parti pour Folding@home !!!
    Comment savez vous le nombre de WU de votre protéine ?
    Et existe toujours des petits logiciel comme GSpy pour Folding ?
  312. Alexlesioux a dit (le 7 mai 2003 à 02h26)
    Citation:
    Provient du message de Formatman
    Alex il faut changer de programme on en parle depuis quelques semaines déjà
    Je suis complétement ailleurs en ce moment merci... :rolleyes:
  313. streets a dit (le 13 mai 2003 à 19h13)
    Citation:
    Provient du message de streets
    bienvenu Stan, tu le saura je crois une foit un genome de crée
    c a dire apres les 30 sequances de calculées et le resutat envoyé.

    Sinon prochainement 2 PC vont po tourner pendant 3 semaines
    pour cause de vacances forcées
    Voila ,retour de vacance in Poland en passant par l'Allemagne (2jours passé la bas) , 3 semaines ca fait du bien. . . :cool:
    Les 2 pc de chez moi vont pouvoir regenomisé et je vais povoir me remetre a renewser . . .
  314. Werner a dit (le 13 mai 2003 à 19h31)
    Ah c'est une bonne nouvelle
  315. streets a dit (le 13 mai 2003 à 22h55)
    tien g viens de voir ke NDFR fait du f@h aussi . . . c koi la config recomandé pour ca . . . si je me rappel bien ca met plus de tps que du g@h

    Citation:
    Le numéro de l'équipe :

    Saisissez 704901201 pour NewdimensionFR (Gen@Home)

    ou

    Saisissez 31922 pour NewdimensionFR (Folding@Home)
  316. Cougar a dit (le 13 mai 2003 à 23h05)
    bah le f@h y a que nortonghost qui en fait
    sinon le reste c''est du g@h
  317. streets a dit (le 13 mai 2003 à 23h12)
    yep je viens de voir , il doit se sentir tous seul alors si je pouvais l'aider . . .
  318. Cougar a dit (le 13 mai 2003 à 23h23)
    nan, G@h d'abord
  319. Werner a dit (le 14 mai 2003 à 15h38)
    Citation:
    Provient du message de streets
    tien g viens de voir ke NDFR fait du f@h aussi . . . c koi la config recomandé pour ca . . . si je me rappel bien ca met plus de tps que du g@h
    Je viens de tester justement un client G@H + un client F@H en même temps sur un PIV 3.06 GHz... seulement 19.7 points en + de 24 heures. C'est comme qui dirait très long
  320. Werner a dit (le 16 mai 2003 à 13h08)
    C'est bientôt le week end ils nous font encore un petit coup de :

    Citation:
    Error: Could not transmit unit 07 (completed May 16). Keeping unit in queue.
    :angry:
  321. highlander a dit (le 16 mai 2003 à 14h21)
    J'ai vu ici Qu'ils allaient changer le core du programme le 19/05/03

    Il nous on fait une B.A. à la Matrix
  322. streets a dit (le 16 mai 2003 à 21h22)
    ba je vais le voir demain - Matrix 2 :banana:
    donc apparament il y'aura un new programme dés Lundi :cool:
  323. Werner a dit (le 20 mai 2003 à 08h53)
  324. Cougar a dit (le 20 mai 2003 à 08h56)
    y en a qui se prennent pas pour de la merde
  325. Werner a dit (le 20 mai 2003 à 08h59)
    Et les versions betas pas très dur à trouver

    http://www.stanford.edu/group/pandegroup/release/beta/
  326. Cougar a dit (le 20 mai 2003 à 09h03)
    3.24-->3.25, ça sent pas la révolution lol
  327. Werner a dit (le 20 mai 2003 à 09h05)
    Pour l'instant ça change pas grand chose lol vu que nous les genomiens ont a tjrs le même core (de rêve)
  328. streets a dit (le 20 mai 2003 à 13h32)
    tiens y'a plus de date d'un coup
    y marche po le lien sur le flash en plus
  329. Spycam a dit (le 20 mai 2003 à 22h34)
    Pour info, depuis le 1er octobre 2000, 100 000 personnes ont participé à Folding@home.



    ( Je sais c'est marqué sur la page principale de leur site mais c'est toujours intéressant à savoir quand on a pas le temps d'y aller )
  330. Werner a dit (le 21 mai 2003 à 19h47)
    Et aujourd'hui nous avons dépassé les 100 000 unités (100634.67 pour être plus précis) soit 3909 gênes créés
  331. highlander a dit (le 22 mai 2003 à 00h35)
    Et en nombre d'unité par jour nous sommes 10 ieme
    C'est pas mal quand même
  332. Cougar a dit (le 22 mai 2003 à 06h56)
    enfin comme tout ceux qui ont installé le nouveau client ont pas pensé à selectioné "gah", ils font que du calculs folding@home qui est pas pris en compte dans les stats genomes
  333. streets a dit (le 23 mai 2003 à 00h32)
    ba ca m'etonne Cougar , il n'y a que 2 resustat pour le folding
    celui de Format et nonoghost.
  334. Cougar a dit (le 23 mai 2003 à 00h46)
    je dis pas notre team, mais toutes les autres, quand tu regardes les stats, tu t'apercoit que y a plus que 300 teams qui fournissent des résultats pour le génome.
  335. Spycam a dit (le 23 mai 2003 à 19h11)
    A chaque fois que folding se ferme de travers ( ce qui arrive fréquement ), çà m'affiche çà et çà bouge plus !!! :
    [16:03:05] - Ask before connecting: No
    [16:03:05] - Use IE connection settings: Yes
    [16:03:05] - User name: Spycam100 (Team 704901201)
    [16:03:05] - User ID = 21918BC47E90080C
    [16:03:05] - Machine ID: 1
    [16:03:05]
    [16:03:05] Loaded queue successfully.
    [16:03:05] + Benchmarking ...
    [16:03:07]
    [16:03:07] + Processing work unit
    [16:03:07] Core required: FahCore_65.exe
    [16:03:07] Core found.
    [16:03:07] Working on Unit 01 [May 23 16:03:07]
    [16:03:07] + Working ...
    [16:03:08] Folding@Home Client Core Version 2.47 (June 14, 2002)
    [16:03:08]
    [16:03:08] Proj: work/wudata_01
    [16:03:08] Done: 23189 -> 142971 (decompressed 616.5 percent)
    [16:03:08] nsteps: 5000000 dt: 2.000000 dt_dump: 250.000000 temperature: 298.000
    000
    [16:03:08] xyzfile:
    [16:03:08] " 393 p638_L939_K12M_ext
    [16:03:08] 1 N 5.057705 1.783549 2.441836 20..."
    [16:03:08] keyfile:
    [16:03:08] "parameters ./proj638.prm
    [16:03:08] NOVERSION
    [16:03:08] ARCHIVE
    [16:03:08]
    [16:03:08] cutoff 16.0
    [16:03:08] taper 12...."
    [16:03:08]
    [16:03:08] - Couldn't get size info for dyn file: work/wudata_01.dyn
    [16:03:08] Starting from initial work packet
    [16:03:08]
    [16:03:08] Protein: p638_L939_K12M_ext
    [16:03:08] - Run: 150 (Clone 77, Gen 0)
    [16:03:08] - Frames Completed: 0, Remaining: 400
    [16:03:08] - Dynamic steps required: 5000000
    [16:03:08]
    [16:03:08] Writing local files:
    [16:03:08]
    [16:03:08] parameters work/wudata_01.prm
    [16:03:08] - Writing "work/wudata_01.key": (overwrite) successful.
    [16:03:08] - Writing "work/wudata_01.xyz": (overwrite) successful.
    [16:03:09] - Writing "work/wudata_01.prm": (overwrite) successful.
    [16:03:09] - Writing "work/wudata_01.key": (append) successful.
    [16:03:09]
    [16:03:09] PROJECT="work/wudata_01", NSTEPS=5000000, DT=2.0000, DTDUMP=25.000000
    , TEMP=298.00
    [16:03:10] TINKER: Software Tools for Molecular Design
    [16:03:10] Version 3.8 October 2000
    [16:03:10] Copyright (c) Jay William Ponder 1990-2000
    [16:03:10] portions Copyright (c) Michael Shirts 2001
    [16:03:10] portions Copyright (c) Vijay S Pande 2001

    Je suis ensuite obligé d'effacer le core, pour qu'il refonctionne...
    Je reste calme mais si çà continue le PC va faire un vol !!!
    Une solution docteur Formatman ?
  336. Werner a dit (le 23 mai 2003 à 19h27)
    Je ne vois pas mais en tout cas il te télécharge le core folding et vu le numéro d'équipe qui est rentré tes points vont dans l'équipe "poubelle"
  337. Spycam a dit (le 23 mai 2003 à 19h56)
    Pourquoi ? Lequel faut entrer ?
    ( :confused: )
  338. Werner a dit (le 23 mai 2003 à 20h08)
    704901201 pour NewdimensionFR (Gen@Home)

    ou

    31922 pour NewdimensionFR (Folding@Home)

  339. Spycam a dit (le 23 mai 2003 à 20h51)
    Comment faire pour kil télécharge le core genome ? ( je ne ve pas faire du folding ya presque personne ki en fait ! ). :bandit:
  340. nonoghost a dit (le 24 mai 2003 à 00h21)
    Laisse tomber, je viens juste de m'y remettre etant donné le bordel que c'est :angry: je sais pas si je vais le garder longtemps....

    On va voir si mes stats grimpent...
  341. Cougar a dit (le 24 mai 2003 à 01h27)
    Citation:
    Provient du message de Spycam
    Comment faire pour kil télécharge le core genome ? ( je ne ve pas faire du folding ya presque personne ki en fait ! ). :bandit:
    quand tu lances pour la preières fois FAHConsole.exe tu remplies les informations...puis quand il te demande de configurer les "advanced option" tu met yes, et là tu mettras gah quand t'auras le choix entre gah/fah/nopref.

    et là tu feras exclusivement du genome
  342. Spycam a dit (le 24 mai 2003 à 13h34)
    Merci.
    J'ai fait ce que tu as dit :

    Citation:
    [10:22:03] Configuring Folding@home...

    User name [Anonymous]? Spycam100
    Team Number[0]? 704901201
    Ask before fetching/sending work [no] (yes/no)? no
    Use Internet Explorer Settings [no] (yes/no)? yes
    Change advanced options [no] (yes/no)? yes
    Core Type [no-pref] (no-pref/fah/gah)? gah
    Core Priority [idle] (idle/low)? idle
    CPU usage requested (5-100)? 80
    Disable highly optimized assembly code [no] (no/yes)? no
    Ignore deadline information (mainly useful if
    system clock frequently has errors)? [no] (no/yes)? no
    Machine ID (1-4) [1]? 1
    [10:23:28] - Ask before connecting: No
    [10:23:28] - Use IE connection settings: Yes
    [10:23:28] - User name: Spycam100 (Team 704901201)
    [10:23:28] - User ID = 21918BC47E90080C
    [10:23:28] - Machine ID: 1
    [10:23:28]
    [10:23:28] Work directory not found. Creating...
    [10:23:28] Could not open work queue, generating new queue...
    [10:23:28] + Benchmarking ...
    [10:23:30] + Attempting to get work packet
    [10:23:30] - Connecting to assignment server
    [10:23:35] - Successful: assigned to (171.64.122.125).
    [10:23:35] + News From Folding@Home: Welcome to Folding@Home
    [10:23:36] Loaded queue successfully.
    [10:23:37] - Deadline time not received.
    [10:23:40] + Closed connections
    [10:23:40]
    [10:23:40] + Processing work unit
    [10:23:40] Core required: FahCore_ca.exe
    [10:23:40] Core not found.
    [10:23:40] - Core is not present or corrupted.
    [10:23:40] - Attempting to download new core...
    [10:23:40] + Downloading new core: FahCore_ca.exe
    [10:23:44] + 10240 bytes downloaded
    [10:23:44] + 20480 bytes downloaded
    [10:23:44] + 30720 bytes downloaded
    [10:23:44] + 40960 bytes downloaded
    [10:23:44] + 51200 bytes downloaded
    [10:23:44] + 61440 bytes downloaded
    [10:23:44] + 71680 bytes downloaded
    [10:23:44] + 81920 bytes downloaded
    [10:23:44] + 92160 bytes downloaded
    [10:23:44] + 102400 bytes downloaded
    [10:23:44] + 112640 bytes downloaded
    [10:23:44] + 122880 bytes downloaded
    [10:23:44] + 133120 bytes downloaded
    [10:23:44] + 143360 bytes downloaded
    [10:23:44] + 153600 bytes downloaded
    [10:23:44] + 163840 bytes downloaded
    [10:23:44] + 174080 bytes downloaded
    [10:23:44] + 184320 bytes downloaded
    [10:23:44] + 194560 bytes downloaded
    [10:23:44] + 204800 bytes downloaded
    [10:23:44] + 215040 bytes downloaded
    [10:23:44] + 225280 bytes downloaded
    [10:23:44] + 235520 bytes downloaded
    [10:23:44] + 245760 bytes downloaded
    [10:23:44] + 256000 bytes downloaded
    [10:23:44] + 266240 bytes downloaded
    [10:23:44] + 276480 bytes downloaded
    [10:23:44] + 286720 bytes downloaded
    [10:23:44] + 296960 bytes downloaded
    [10:23:44] + 307200 bytes downloaded
    [10:23:44] + 317440 bytes downloaded
    [10:23:44] + 327680 bytes downloaded
    [10:23:44] + 337920 bytes downloaded
    [10:23:44] + 348160 bytes downloaded
    [10:23:44] + 358400 bytes downloaded
    [10:23:44] + 368640 bytes downloaded
    [10:23:44] + 378880 bytes downloaded
    [10:23:44] + 389120 bytes downloaded
    [10:23:44] + 399360 bytes downloaded
    [10:23:44] + 409600 bytes downloaded
    [10:23:44] + 419840 bytes downloaded
    [10:23:44] + 430080 bytes downloaded
    [10:23:44] + 440320 bytes downloaded
    [10:23:44] + 450560 bytes downloaded
    [10:23:44] + 460800 bytes downloaded
    [10:23:44] + 471040 bytes downloaded
    [10:23:44] + 480026 bytes downloaded
    [10:23:44] Verifying core Core_ca.fah...
    [10:23:44] Signature is VALID
    [10:23:44] Created: Wednesday April 10, 2002 00:01:22 UTC
    [10:23:44] Signed: Monday March 3, 2003 00:18:15 UTC
    [10:23:44]
    [10:23:44] Trying to unzip core FahCore_ca.exe
    [10:23:45] Decompressed FahCore_ca.exe (1466368 bytes) successfully
    [10:23:45] + Core successfully engaged
    [10:23:50]
    [10:23:50] + Processing work unit
    [10:23:50] Core required: FahCore_ca.exe
    [10:23:50] Core found.
    [10:23:50] Working on Unit 01 [May 24 10:23:50]
    [10:23:50] + Working ...
    [10:23:50] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
    [10:23:50]
    [10:23:50] Proj: work/wudata_01
    [10:23:50] Finding work files
    [10:23:50] sizeof(CORE_PACKET_HDR) = 512
    [10:23:50] Checking frame files
    [10:23:50] - Couldn't open work/wudata_01.chk
    [10:23:50] Starting from initial work packet
    [10:23:50]
    [10:23:50] Updating shared core-client information
    [10:23:50] - Writing "work/wudata_01.key": (overwrite)successful.
    [10:23:50] Key file to update shared file: work/wudata_01.key
    [10:23:50] keyfile: 0 68 200 15 2 1 0
    [10:23:50] Protein: SH3ligGH2/pdb1abo.1.spa
    [10:23:50] - Frames Completed: 0, Remaining: 600
    [10:23:50] - Dynamic steps required: 120000
    [10:23:50]
    [10:23:51] Printed current.prm
    [10:23:51] Writing local files:
    [10:23:51] - Writing "work/wudata_01.key": (overwrite)successful.
    [10:23:51] - Writing "work/wudata_01.xyz": (overwrite)successful.
    [10:23:51] - Writing "work/wudata_01.prm": (overwrite)successful.
    [10:23:52] Starting design engine
    [10:23:52] [SPG] project name: work/wudata_01.
    [10:23:52] [SPG] 1 0
    [10:23:52] [SPG] Unrecognized atom
    [10:23:52] [SPG] Unrecognized atom
    [10:23:52] [SPG] Initializing protein design engine
    [10:23:52] [SPG] seed = 0
    [10:23:52] [SPG] Initialization complete
    [10:23:52] [SPG] Writing current.pdb, chainlength = 68
    [10:23:52] [SPG] Writing current.xyz
    [10:23:52] [SPG] Preprocessing . . .
    [10:23:52] [SPG] 68 positions in protein
    [10:24:50] [SPG] Preprocessing complete
    [10:25:00] Iterations: 0 of 600
    [10:25:00] Finished
    [10:25:00] [SPG] Native chi angles stored
    [10:25:00] [SPG] Rotamers read
    [10:25:00] [SPG] Unrecognized atom
    [10:25:00] [SPG] Unrecognized atom
    [10:25:00] [SPG] Starting genetic algorithm
    J'espère que çà marchera.
    Je sait pas pourquoi mais j'ai l'impression que c'est le core folding qu'il a téléchargé ! "Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)". :confused:
    Je me trompe ?
  343. Cougar a dit (le 24 mai 2003 à 13h37)
    c'est normal
    normalement c'est bon .
  344. BeClaude a dit (le 25 mai 2003 à 01h23)
    Salut à tous,

    Je vous signale l'arrivé d'un ami qui ce met dans l'équipe

    DelfinO XP2000+ = 1.667GHz

    Merci DelfinO et bienvenue dans l'équipe
  345. DelfinO a dit (le 25 mai 2003 à 01h42)
    Yo c moi DelfinO
  346. highlander a dit (le 25 mai 2003 à 03h12)
    Bienvenue chez les Génomisateur DelfinO
  347. Werner a dit (le 25 mai 2003 à 05h18)
    Bienvenue dans l'équipe DelfinO
  348. BeClaude a dit (le 25 mai 2003 à 18h58)
    Salut à tous,

    Et mialin c'est mon frero avec un celeron 1 000 Mhz OV a 1300 Mhz

    Pour ma part j'ai pas compris mon dernier resultat est pas encore pris en compte j'ai refait la config du client j'espere que je ne fesait pas du Folding ???!!!!!!!!!!
  349. Werner a dit (le 25 mai 2003 à 22h10)
    Le frero est ajouté dans la liste
  350. Mala a dit (le 27 mai 2003 à 16h03)
    Une nouvelle recrue pour moi, un petit Duron 1.2 Ghz en plus ce qui me fait un total de 4.867 normalement

    Allez au boulot tout le monde
  351. DelfinO a dit (le 27 mai 2003 à 19h12)
    Euh, je n'ai pas tout suivi, au début, il calcule pour genome@home mais maintenant, il calcule folding@home je crois..... ? pourtant je n'ai pas touché ce progs depuis le début non stop. (genre il calcule 120 000 / 500 000)
  352. Cougar a dit (le 27 mai 2003 à 19h26)
    Ton client.cfg se présente comme ça (à ouvrir avec le bloc note) :
    Code:
    [settings]
    username=NDFRCougar
    team=704901201
    asknet=no
    machineid=1
    local=49
    
    [http]
    active=no
    host=localhost
    port=8080
    usereg=yes
    usepasswd=yes
    
    [clienttype]
    type=2
    
    [core]
    priority=96
    cpuusage=100
    disableassembly=no
    ignoredeadlines=no
    vérifie que t'es bien 2 en face de type.
    si c'est pas le cas, met le
  353. DelfinO a dit (le 27 mai 2003 à 19h52)
    oulà, c tout completement différents :

    [settings]
    username=DelfinO
    team=704901201
    asknet=no
    machineid=1
    local=8

    [http]
    active=no
    host=localhost
    port=8080
    usereg=no
  354. DelfinO a dit (le 27 mai 2003 à 19h57)
    Je vous montre mes historiques :

    Voici le derniere changement automatique genome vers folding....

    [22:39:27] [SPG] Writing current.xyz
    [22:39:27] [SPG] Sequence 30 completed:
    [22:39:27] NLVAIWPYQAPTSNTLGYPSGFIMVPLNPNVGPYLYTWDPATGTKGAVPW . . .
    [22:39:27] Iterations: 600 of 600
    [22:39:28] Finished
    [22:39:29] [SPG] Design complete
    [22:39:29] [SPG] completed successfully
    [22:39:29]
    [22:39:29] Finished Work Unit
    [22:39:29] work_hdr.len_arcfile: 112200
    [22:39:30] Leaving Run
    [22:39:32] - Writing 112712 bytes of core data to disk.
    [22:39:32] end (WriteWorkResults)
    [22:39:32] - Shutting down core
    [22:39:32]
    [22:39:32] Folding@Home2 Protein Design Core Shutdown: FINISHED_UNIT
    [22:39:32] Left some temporary files
    [22:39:35] CoreStatus = 64 (100)
    [22:39:35] Sending work to server


    [22:39:35] + Attempting to send results
    [22:39:44] + Results successfully sent
    [22:39:44] Thank you for your contribution to Folding@home.
    [22:39:44] + Number of Units Completed: 7
    [22:39:48] + Attempting to get work packet
    [22:39:48] - Connecting to assignment server
    [22:39:49] - Successful: assigned to (171.64.122.144).
    [22:39:49] + News From Folding@Home: Welcome to Folding@Home
    [22:39:49] Loaded queue successfully.
    [22:40:02] + Closed connections
    [22:40:02]
    [22:40:02] + Processing work unit
    [22:40:02] Core required: FahCore_78.exe
    [22:40:02] Core not found.
    [22:40:02] - Core is not present or corrupted.
    [22:40:02] - Attempting to download new core...
    [22:40:02] + Downloading new core: FahCore_78.exe
    [22:40:04] + 10240 bytes downloaded
    ... downloading
    [22:40:16] + 603591 bytes downloaded
    [22:40:16] Verifying core Core_78.fah...
    [22:40:16] Signature is VALID
    [22:40:16] Created: Wednesday April 10, 2002 00:01:22 UTC
    [22:40:16] Signed: Thursday April 3, 2003 00:01:22 UTC
    [22:40:16]
    [22:40:16] Trying to unzip core FahCore_78.exe
    [22:40:16] Decompressed FahCore_78.exe (1728512 bytes) successfully
    [22:40:16] + Core successfully engaged
    [22:40:21]
    [22:40:21] + Processing work unit
    [22:40:21] Core required: FahCore_78.exe
    [22:40:21] Core found.
    [22:40:21] Working on Unit 08 [May 26 22:40:21]
    [22:40:21] + Working ...
    [22:40:21]
    [22:40:21] *------------------------------*
    [22:40:21] Folding@home Gromacs Core
    [22:40:21] Version 1.48 (May 7, 2003)
    [22:40:21]
    [22:40:21] Preparing to commence simulation
    [22:40:21] - Looking at optimizations...
    [22:40:21] - Created dyn
    [22:40:21] - Files status OK
    [22:40:22] - Expanded 510614 -> 2524929 (decompressed 494.4 percent)
    [22:40:22] - Starting from initial work packet
    [22:40:22]
    [22:40:22] Project: 909 (Run 41, Clone 86, Gen 1)
    [22:40:22]
    [22:40:22] Assembly optimizations on if available.
    [22:40:22] Entering M.D.
    [22:40:28] Protein: p909_vill_str0
    [22:40:28]
    [22:40:28] Writing local files
    [22:40:30] Extra 3DNow boost OK.
    [22:40:32] Writing local files
    [22:40:32] Completed 0 out of 250000 steps (0)
    [22:48:32] Writing local files
    [22:48:32] Completed 2500 out of 250000 steps (1)



    Voilà qu'en pensez vous ?
  355. Cougar a dit (le 27 mai 2003 à 19h59)
    bah tu peux mettre tout comme moi (sauf l'username bien sur)

    "Quand tu lances pour la preières fois FAHConsole.exe tu remplies les informations...puis quand il te demande de configurer les "advanced option" tu met yes, et là tu mettras gah quand t'auras le choix entre gah/fah/nopref. "

    Ou tu peux modifier dès maintenant le client.cfg à la main, au ipre si ça marche toujours pas du supprimes tous les fichiers sauf fahconsole.exe

    jvais ptet faire un prog permettant de corriger ça, histoire de m'occuper un peu
  356. DelfinO a dit (le 27 mai 2003 à 20h07)
    D'accord mais pourquoi il change le programme genome en folding tout seul....

    t'as regardé, c bien çà folding@home alors ? si oui je vais fermer et relancer.
  357. Cougar a dit (le 27 mai 2003 à 21h18)
    bah pasque pendant l'installation, t'as pas spécifié les "advenced options", du coups le programme fait soit du genome, soit du folding, si par contre tu précises fah (type=2) il ne fera QUE du genome

    D'après tes logs tu faisais du folding
  358. mialin a dit (le 28 mai 2003 à 22h24)
    bonjour de mialin
  359. streets a dit (le 8 février 2004 à 00h06)
    Ba ca fait longtemps qui'il est down ce topic

    Alors up avec la version 4 de Folding@Home qui est sortit je ne sais quand d'ailleur . . . :rolleyes:
    Allez voir par ici si ca vous dit
  360. childerik a dit (le 8 février 2004 à 00h41)
    Streets, tu tiens tant que çà de battre le record ? .
  361. Matt a dit (le 8 février 2004 à 02h09)
    Il est loin du record là
  362. streets a dit (le 9 février 2004 à 13h44)
    Citation:
    Originellement posté par Matt
    Il est loin du record là
    ba petit a petit avec un PC qui tourne je vais p-e depasser formatman
  363. Werner a dit (le 9 février 2004 à 15h18)
    Ne me provoque pas Streets
  364. streets a dit (le 9 février 2004 à 19h29)
    Citation:
    Originellement posté par Formatman
    Ne me provoque pas Streets
    si si et les autres aussi
  365. Cougar a dit (le 19 avril 2004 à 15h43)
    Je viens de réinstaller la V4.0 en la voyant sur clubic
    je rappelle le num de la team 31922
    si y a d'autres amateurs (uniquement folding@home)
  366. Werner a dit (le 19 avril 2004 à 20h33)
    Je viens de l'installer aussi et je constate une nouvelle fois qu'il faut lancer autant de progr qu'on a de CPU j'ai donc arrêté... le jour où ils feront un vrai programme multi CPU je me laisserai tenter
  367. Cougar a dit (le 19 avril 2004 à 20h59)
    Lance juste un cpu alors
    Formatman on t'aiiiiiiiiime

Ajouter un commentaire

Afficher l'actualité “Venez Genomiser avec nous !” sur le forum